SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000007 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000007
Domain Number 1 Region: 694-1049
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-110
Family Hect, E3 ligase catalytic domain 0.000000231
Further Details:      
 
Domain Number 2 Region: 2-384
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.88e-99
Family Regulator of chromosome condensation RCC1 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000007   Gene: ENSTNIG00000011048   Transcript: ENSTNIT00000001665
Sequence length 1057
Comment pep:known_by_projection chromosome:TETRAODON8:18:7427057:7434952:1 gene:ENSTNIG00000011048 transcript:ENSTNIT00000001665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGKAKDGQLGIEVERNSMFEPRNCNVFSGRGLKEAVCGGQHSVFLLHDGSVYTCGSN
GCGQLGHNKPGTSPELVGALDTQRITLVSCGQAHSMAVNEQGQVFAWGAGDGGQLGLGTT
EAAVRIPSFPRLIKRLCDHRIAQVMCGNQHCIALSKDGQLFTWGQNTSGQLGLGKGEPSK
LFPQPLKSLAGIPLAKITAGGDHSFALSLSGAVFGWGKNKAGQLGLNDIQDRAVPCHIKF
LRSQKVVHISCGDEHTAALTKDGGLFTFGDGSWGQLGHGSTSNELLPRRVLELMGTEVSQ
ITCGRHHTLAFAPSSGVVYAFGGNSHGQLGTGELSAEKCLYPVKINLLSGNNHRTGKQNI
CPVRKYSVTKITCGGDHSFLLYSNEQSLEYPEDFRVINIGNSISPINYERLNSWRLKMMC
NKDSTVTNDINIQLSSTACWNASFLDQSDDAHFSTNPKIPGIDLNSVRMFFATLSTPAFS
ALLEQATKSFESVLIPQLPRSPPDVEAMRIYLILSEYPALQDTKNYIRLTIPLAMAILRL
DANPSKVLDNWWCFVDDGVFTRMVDIYKSIVVFLLRGGKTLLLPISYENYFVATLRLLEK
LHKVNLKAHHVEYNHFYIPDITSMVDIQEDYLKWFLSKAQIKVESPSPSQTDFPSVNLCA
YPFLLNAQAKTTMLQTDAELQMQMAVSGANLHNVFMLLTLEPQLARNPYLVLHVRRNHLV
SDVRELTSYSDVDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELMDPIYGMFTFHNESN
LLWFSDKCFVEQKWFHLIGIICGLAIYNSTVVDLHFPLALYKKLLDVSPTLEDLKELSPT
EARSLQQLLDYENEDVEETFLLSFAITRENYGIIEVKELVPGGESISVDKNNRKEFVEAY
LRYIFSDSASEQYSAFSAGFLKVCGGEILSLFQPCELMAMVVGNSNYNWEVMEKNTVYKG
EFTATHPTVRLFWEVFHEFPLEKKKQFLLFLTGSDRIPIHGMESLRIVIQSTMAEERYLP
VAHTCYNLLDMPRYQTKEILRCRLTQAVEQYEGFSLV
Download sequence
Identical sequences H3BVJ5
ENSTNIP00000000007 ENSTNIP00000000007 99883.ENSTNIP00000000007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]