SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000009 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000009
Domain Number 1 Region: 289-413
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.51e-26
Family Regulator of G-protein signaling, RGS 0.0021
Further Details:      
 
Domain Number 2 Region: 504-640
Classification Level Classification E-value
Superfamily PX domain 6.8e-22
Family PX domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000009
Domain Number - Region: 245-277
Classification Level Classification E-value
Superfamily ISY1 domain-like 0.0106
Family ISY1 N-terminal domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000009   Gene: ENSTNIG00000010119   Transcript: ENSTNIT00000002108
Sequence length 843
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:91900038:91907202:1 gene:ENSTNIG00000010119 transcript:ENSTNIT00000002108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFVILLSLSGLPAVFDLAYRDYILSWYVHLSHDEGQLYSMLSVDWWQMIGQLRSRLARID
LVNVVCYDTIQILHTHFNDLKAASLRPEEGARPFPLHPCLVDPESEVAFLRCVARILLLC
LLPQKDAKSHTLRCCLTEVITTKAVLKPLVDVLSDPDSINRMLLSQLEKREQHLEQQKKA
YTYAASYEDFIKLISTSVDVNFLKQLRYQIVVEIIHATTISNLPQLKKQKERKGKESAAM
KADLLRARDMKRYINQLTVAKKQCEKRIRLLGGPNYENVEEGGTDDNDDPPSQKILQFDD
ILCNPAYRERFRVYMERVDKRALIGFWELVESLKTANKNEVPQIVGELYQKFFVESREIP
VEKCLLREIQQSLVGNTGTQVFIKLQEQVSETMRERYYPSFLVSDLYDNLIRRDEQHSQS
QRGTDEKEGCQDLDPAEEEVCDECGKGINEQASYAATKLRQLRDKLDYKRHALESIQNAP
KPDKKIVSKLKEEIGSMEREHGELQQHMTRTDWWCENLGHWRANITAAEATEEGGEMVAC
YSVCVSLVEGEESTNSRWNVNRKLPEFQMLHRKLTECFPSLKKLQLPSLSKLPFKSIDQK
FLDKSKTQLNAFLQRLLTDERLCQSEALYAFLSPSPEHLKVMSIQKKSSFSLASFLEKLP
GDFFSHTEEDDDDDSDLSDYGDETDGKKDALAEPCFMLIGEIFELRGMFKWVRKTLIALV
QVTFGRTINKQIRDTVNMIICEQMLVNYISVFKDAYWPGGRLAPHVKVRTDSERCETKEQ
AQQKLLDNIPDAVINLVGQQNARNGIIKIFNALQETSANKHLLYVLMEMFLKEMCPELAS
EIA
Download sequence
Identical sequences H3BVJ7
99883.ENSTNIP00000000009 ENSTNIP00000013017 ENSTNIP00000000009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]