SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000027 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000027
Domain Number 1 Region: 39-413
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.83e-48
Family Integrin alpha N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 537-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000259
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000027   Gene: ENSTNIG00000008683   Transcript: ENSTNIT00000001202
Sequence length 626
Comment pep:known_by_projection chromosome:TETRAODON8:17:5342451:5350778:1 gene:ENSTNIG00000008683 transcript:ENSTNIT00000001202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAWVLLFLPPVSSAQRSEPVFSSITKSILPPNYENNPTQLNYGVAVTDVDGDGDLEVFV
AGYNGPNLVLKYIQDQKRLVNIAVDNRSSPFYALRDRQGNAIGVTACDIDGDGREEIYVL
NTNNAFSGRATYSDKLFKFRNGRFEDLLNDDINEHRDVANRMAGRSVACVDRKGTGRYAI
YIANYASGNVGPHALIEMDELASDLSQGVIALSNVAEEAGVNKFTGGRGVVVGPILNQIL
PDVFCDNEYGPNFLFRNNGDGTFTDVAQQAGVEDPMQHGRGVALADFNRDGRTDIVYGNW
NGPHRLFMQLNNRRQKFKDIASQKFSMPSPVRTVIAADFDNDNELEVFFNNIAYRGPSAN
RLFRVSRREHGDPQIEELNVGEASEPEGRGTGAVATDFDGDGRLELLVSHGESAAQPLSV
YKVLQGTSNSWLRVIPRTKFGAFARGAKVVVYTKKSGTHTRIIDGGSGYLCEMEPVAHFG
LGKDVATGVEVYWPDGRSVVRLLEPSDLNSVLEIQYPRDVEVTPTAQTECGHGFALNEKG
RCTDEDECTRYPFACPLDRPVCVNTYGSYRCRAKRRCNQGFEPSDDGSACVAQVAYFGGT
RSFADRKWSGLCFWLLLPHVLRPGLL
Download sequence
Identical sequences H3BVL5
99883.ENSTNIP00000000027 ENSTNIP00000000027 ENSTNIP00000011531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]