SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000064 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000064
Domain Number 1 Region: 10-154
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000153
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000064   Gene: ENSTNIG00000005869   Transcript: ENSTNIT00000001118
Sequence length 750
Comment pep:known_by_projection chromosome:TETRAODON8:1:6885666:6905674:-1 gene:ENSTNIG00000005869 transcript:ENSTNIT00000001118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTAEEERFLDAAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVANEHLEVTELLLK
KDGLARIGDGLLLAISKGYVRIVEAILAHPAFGGGLRLALSPLEQEMRDDDFYAYDEDGT
RFSHDVTPIILAAHCQEYEIVHILLTKGARIERPHDYFCKCSECVEKQKKDSFSHSRSRM
NAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKVEKKSIEEVCSLSHHFLIS
SDESQTQRSILLFVNNHSADGALHAVVRLYRCLSQYEVNVHRHLQEYVVKPRCLSAQVIS
TSFSLSFSGLMKKRNYMWRRLTSHFFHMVHNIHIISLRLIAAEANIGQILRSPFMKFVAH
AVSFTIFLGLLVVNASDRFEDHPRQVFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWSDG
PREYVMHLWNVLDFGMLSIFVASFTARFMAFLKASKARNKWRPSDPQIISEGLYAIAVVL
SFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYLGAKAK
RKGHCKTRFSCEKTNKYFQSLTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLY
GVYNVTMVVVLLNMLIAMINSSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVP
SPKSFYYLVLLFFSTFCSDRCHHLCKRTHNASLFVRTSALGLIHIQKIMKRLIKRYVLKA
QVDRESDEVNEGELKEIKQDISSLRYELLE
Download sequence
Identical sequences H3BVQ2
ENSTNIP00000000064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]