SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000074 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000074
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily PX domain 1.22e-27
Family PX domain 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000074
Domain Number - Region: 127-157
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0123
Family N-terminal coiled coil domain from apc 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000074   Gene: ENSTNIG00000001007   Transcript: ENSTNIT00000002272
Sequence length 169
Comment pep:novel chromosome:TETRAODON8:15:3281874:3283073:-1 gene:ENSTNIG00000001007 transcript:ENSTNIT00000002272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETPPVSLKMVGYEVLHKRSKFTVYKILVKGHQRDSWVIFRRYSDFYKLRDELRELFPSLG
VTLPPKRFFKDNYEKKFLDGRRLGLQTFLQNVTSHQDAVSSEAVQNFLCAVGRLSPFDSL
EESRAVCETLEDSNHHLQMELLDNQREIDTLKKKLEEKENHIRLLVKKL
Download sequence
Identical sequences H3BVR2
99883.ENSTNIP00000000074 ENSTNIP00000000074 ENSTNIP00000000074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]