SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000101 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000101
Domain Number 1 Region: 129-482
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.92e-89
Family Ankyrin repeat 0.00000309
Further Details:      
 
Domain Number 2 Region: 526-786
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.59e-58
Family Ankyrin repeat 0.0000939
Further Details:      
 
Domain Number 3 Region: 763-984
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.51e-43
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 4 Region: 5-110
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000192
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000101   Gene: ENSTNIG00000007078   Transcript: ENSTNIT00000001412
Sequence length 1024
Comment pep:known_by_projection chromosome:TETRAODON8:11:2970266:2984572:1 gene:ENSTNIG00000007078 transcript:ENSTNIT00000001412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRNIKDQSPLVQAIFSRDTEEVTFLLDHNQDASSLDQEQSTPLHAASYLGDVHIMELI
IASGRKLDISHHRHTIFIHQIISLSYGCSLFICIFTGADVNAKGLSLLTPYIEQRVASEV
CLEVVNSQEGTPLDHTAKSGHEKMVSLLLSKGANVNANDKKERKPIHWAAYHGHLEVVKL
LTSQGANVKCKDKQGYTPLHAAAVSGQLDVIKYLLRVVSEIDDSNAYGNTALHMACYTGQ
DTVANELVNCGANINRPNRHGSTPLHLAAASSSGVLCLELLVNNGADVTMQNKEGKSPLH
VAAMHGRFTGSQILIQNGGEIDCVDIFGNTPLHVAARYGQELLISTLLSNGANKSRRRID
GMLPVHLAALYGFPDCCRKLLSNGQFYMTACVKPTVECDINVLDEYGRTCLHAAASGGNI
DCLNLLLNCGADLDIKDHLGRSPLHYAAANKNSQCVVSLVRAGAEVNERDLTGCSPLHCA
AASFNSFGLCRTETSDYDEEKEREASLCLDYLLDSGANPTLRNSKGYSAVHYAAAYGNKQ
HLELLLEISFNCLEEVESNIPVSPLHLAAYYGHCEALRLLCETLVSLDVRDIEGRSALHL
AARRGFAPCVEVLLKHQASYTLKEHRHKWTALHAAAAEGQMDCLLLLVNQEHSADIIDCP
DTKGQTALMLAALGGHIDCVHILLEKGAKADAADTKGFTALHRAAMLGCEGCVSALLEHG
ASALYRDSQGRTPLHLAASLGHTELLQTLLKAAMKSDPLDSMLDYRGYMPVHWAAYHGHE
DCLCILLEKKLFNYKEGNLFTPLHCALVNGHGVSAGLLLKAVGPDIVNARDAKGSRTPLH
SAAYSGKVAGLQLVIDQGAEVNSVDQRGCSALMVAAERGQTRAVEFLLHKAKPDLSLVDI
SNNTALHLACSKGHEMCALLILGEISDCSLINATNGALQMPLHIAARNGLATVVQVLLSR
GAAVMAVDEEGHTPALACAPNKNVAECLALILSTMKPFPPKEASAGTASHFSPLLRNCTI
PANC
Download sequence
Identical sequences H3BVT9
ENSTNIP00000000101 99883.ENSTNIP00000000101 ENSTNIP00000000101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]