SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000106 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000106
Domain Number 1 Region: 51-289,322-347
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.44e-69
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 562-713
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.68e-69
Family Ankyrin repeat 0.000000234
Further Details:      
 
Domain Number 3 Region: 439-558
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00000366
Further Details:      
 
Domain Number 4 Region: 320-427
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-21
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 5 Region: 1006-1065
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000827
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000106   Gene: ENSTNIG00000017311   Transcript: ENSTNIT00000003821
Sequence length 1066
Comment pep:known_by_projection chromosome:TETRAODON8:10:6367423:6391827:-1 gene:ENSTNIG00000017311 transcript:ENSTNIT00000003821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSGISERASSFCTLARRFIMPDQITVSEFVAETNEDYKSPTASNFTTRMSHCRNTVAALE
EALDVDRSVLYKMKKSVKAIYTSGLAHVENEEQYTQALEKFGENCVYRDDPDLGSAFLKF
SVFTKELTALFKNLFQNMNNIITFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKVTKIE
KEKKEHARQHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLI
KYFHAQCNFFQDGLKAVDNLKPSIEKLATDLHTIKQVQDEERKQLTQLRDVLKSALQVEQ
KEDSQVRPSTTYSLHQPQGNKEHGTERSGYLYKKSDGLRKVWQKRKCTAKNGYLTISHGT
ANRPPAKLNLLTCQVKHNPEEKRSFDLISHDRTYHFQAEDDQDCQIWISVLQNSKEEALN
QAFKGDQHVGENNIVQELTKAILVEVKRMTGNDVCCDCGAPNPTWLSTNLGILTCIECSG
IHRELGVHYSRIQSLTLDVLSTSELLLAKNVGNAGFNEIMEACLSAENVVKPTRPAICEQ
VRKDFITAKYTEKRFARKKCPDTTSRLHTLCDAVKARDIFSLIQVYAEGVDLMEPIPLAN
GHELGETALHLAVRLVDRTSLHIVDFLTQNSLNLDKQTVKGSTALHYCCLTDNSECLKLL
LRGKASIDIANEAGETPLDIARRLKHVQCEELLNQALAGKFNAHVHVEYEWCLQHEDLDE
SDEDLDEKPSPLRRDERPVSCYTPSNNSSLGSAGLMKDKQRAFLPSLVNNETYGTILNPG
RPPRRAQLSGLGGPGQSPASGSWKSGTLDAVGRQRSSSDPPNMHPPVPPMRLVSAGGMGA
ALRPPAQPQDSEGDGRVFSLGLCVPGLGPAPAANLSVQSKSGPGGSRRCRRSLPQGEGPF
FWFLLSPNVTHPAGWFPLAAPPFYLAATIRASTEATQTGPSRRSGKVGAAPPSEVSRPLL
PDSFFTCRLRCLFRRPFQLRRYQDAPRTPEFSFPKPERLVFQKQRPKRVKAVYNCVADNP
DELTFAEGEVIVVDGEEDQEWWLGHIEGEPMRRGAFPVTFVHFISD
Download sequence
Identical sequences H3BVU4
ENSTNIP00000000106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]