SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000152 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000152
Domain Number 1 Region: 172-315
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-34
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 66-174
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-31
Family Second domain of FERM 0.0000963
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-22
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000152   Gene: ENSTNIG00000011362   Transcript: ENSTNIT00000003744
Sequence length 554
Comment pep:known_by_projection chromosome:TETRAODON8:5:2394870:2401736:-1 gene:ENSTNIG00000011362 transcript:ENSTNIT00000003744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQMKSQPPFTMCLR
VKFYPPDPVALKEEITRYLVFLQVKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKH
PEGYCSKFQFFPKHSEKLERRIAEIHKTELIRRGQCPETSELNFLQKAQMLETYGVDPHP
CKDVSGNPAFLAFTPFGFTVLQGNRRIHFLKWDEVTKLKFEAKTFHIYANQNEDRKIILT
YFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGKVAKEVMEQS
AKIKRDPPEIHSVPRTRRRAVHISIMEGTAQKNYGQVFDPDPDEGERSPAHGKPLLPRCE
GLESLRDSAHSTPVRSVSHSDSFMSSQGHMADSGEVSASGVISDEAYSPSDSVLPTPVAE
HGAEVPPARHLNGAPCSVDEEDSEAAAAPKEGQRGDCGRRGLGLVRRRPPPPSEVQELNK
FMLSVLRLFLVTMGLLFALLLLLIVLTESELDIAFLRDIRKTPEFQQFHFEYFCPLRRWF
ACKLRWMGGFLISK
Download sequence
Identical sequences H3BVZ0
99883.ENSTNIP00000000152 ENSTNIP00000000152 ENSTNIP00000000152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]