SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000199 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000199
Domain Number 1 Region: 8-131
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-27
Family Ankyrin repeat 0.00076
Further Details:      
 
Domain Number 2 Region: 679-727
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000353
Family LEM domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000199   Gene: ENSTNIG00000000842   Transcript: ENSTNIT00000003615
Sequence length 938
Comment pep:known_by_projection chromosome:TETRAODON8:1:18556998:18562281:1 gene:ENSTNIG00000000842 transcript:ENSTNIT00000003615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKMSRLENQLCQAVEDGDPRSVQLLLTQGARPDLVGRKGVAAVHLAAGRETERNTRCLKL
LLQHGADPDIKSSEGLTPLHIAALWGCYQNLKLLLMNGGDPKTKDNDGNTPRQLAEQQEN
RKCAQLLQEYQGSSADTEDDDLPQFQYSLYSDQTDTSGYPESDYSRVSDVEPKMCDLNRS
SSHWGPDCPSILSSTRVSAAGPAAPLQLFKEHRWDSTVDMFALKANEESPSSDDKDSPSR
KDALSAFHRRQTSRKSVSFRDVDEYFPVFSPEAPRPQSHADFELSKYSDFLDTERMATVL
PQQGIDVTSPDHVYVFFRESSESAEEEMEKTVMNHLALEESDDEEESEPKTEAVSKKAAS
PPVASSSSGTGSSRYSSCDSDHYTSALDASVHPREQRFAEAEPDGKVKISSQADKNGRCS
DVQTEAQTDEDKFTPSPFVTGRTRSRMSRCSLRTSKTPESLLFTSSLFDDSLPTPIRNRR
HKREARSTEDDHSDTTGDSPTQPGTLGPGSSVGSTLADTLILSKSTSDSVETQTLSDTIV
LEKDEDTSECSSQSDSASASSGSSSFSPRGSSENSDVPCTPGTGCTPRYSMSRLSSCRRP
QHLANLSYTPGGRPHILDVDEPVEYLYTDTEQGHRLIETHIPPTSNTSLSSSMSSSSGDE
TVLYDWRSMQADAKKSGAIPDTAGMTDKELRRRLVELGESPGPISRHTRPTYMRRLCRLM
ESNSPSPQQHLGYSPELCLALRTFELPLCHSDEQALCQQFDQADQNRKWREGVIKSCFNY
LLLDPRVTKNLPFRSHTMSPQECFQTFIQAIFYVGKGKRSRPYSHLYEALEYHRGDKTSK
NLCPKVKHILQVWNSGHGVISLHCFQNVIPVEAYTREACMVDAVGLRMLTNRKRGDFYGV
VSNWLPKRKRELGIHLLHRAMQIFLAEGERQLRPLDIR
Download sequence
Identical sequences H3BW37
ENSTNIP00000000199 ENSTNIP00000000199 99883.ENSTNIP00000000199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]