SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000200 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000200
Domain Number 1 Region: 126-403
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-72
Family Protein kinases, catalytic subunit 0.00000000198
Further Details:      
 
Domain Number 2 Region: 401-452
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000585
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1010-1052
Classification Level Classification E-value
Superfamily UBA-like 0.0000571
Family TS-N domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000200
Domain Number - Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0408
Family SAM (sterile alpha motif) domain 0.009
Further Details:      
 
Domain Number - Region: 1053-1089
Classification Level Classification E-value
Superfamily UBA-like 0.0511
Family UBA domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000200   Gene: ENSTNIG00000007877   Transcript: ENSTNIT00000000085
Sequence length 1097
Comment pep:known_by_projection chromosome:TETRAODON8:15:2791062:2797921:-1 gene:ENSTNIG00000007877 transcript:ENSTNIT00000000085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCEEGTDWLLELLMEVQLQQYFLRIRDDLNVTRLSHFDYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRPDGGDFPQQGQPTSSFRKPSPPPQEGVPALQLDGQH
QALTCLISEKDLTLFQKLGDGSFGVVKRGEWLTPAGKVLNVAVKCLKTDVLSQPEALEDF
ICEVNAMHSLDHQNLIRLYGVVLTHPMKMVTELAPLGSLLERLRCVRPQGPVLIHTLCQY
AVQVSCGMAYLEQRRFIHRDLAARNILLASANKVKIGDFGLMRALPNNHEHYVMQEHRKV
PFAWCAPESLKTRTFSHATDTWMFGVTLWEMFTHGQEPWLGLNGSQILHKIDKEGERLPK
PEDCPQDIYNVMLQCWAQKPDDRPTFVALREFLLETMPTDMCALEDFDEPDKLHIQINDV
ITIIEGRAENYWWRGQNKRTLKVGQFPRNVVTSVAGLSAHDISRPLKNSFIHTGHGDSNP
RRCWGFPDRIDDLYLGNPMDPPDVIGVDLGDARPTQLPGRAKKEPPPRPPQPAVLIKKPC
YDPVHDDEEDQNVVALKRPPLRKSGSVKGLKLKPAARVAASKPGYNPSRDVSLIDFGEEN
PPPTPSPVVEVQVPSLARLVLEAENLLDRTPPQSPCRSLPRPLHPTPVVDWDARPLPPPP
AYDDVAQDEDDMEVSAINTSEQHEEKRSEGPDESSAKETERDVLLTCGTERPVLEDNLFL
PSRQNQGLSTSFSQSAEIFQELQQECMRRLNVPTGSVPVPVPPSQLQAWDGHQESVLSNE
NKPQIPPRVPLPPRPVKRGEHPAARWSRDLSPTPADPTEDGSGAAPDHPPQVPPREPLSQ
PGSRTPSPRGLVVGSPHYSCYLSTSPGKLMATTHSFASDPNYAAAKVSQAQGKEAPSRGP
CILPIVQDGRKVSSTHYYLLPERPPYLDRYDRFFREAENLAASGGRPANTATVRPMVLTQ
QAELKANFSSNNNSSLGGARSGMKTSASLPRVCSDGLTAPTGPASCGGTDGGTSSAARVK
LVQEAVHGVTLEECQAALQNHGWNVQKAVHYLKVEQLFCLGLRSRSECLKLLETCDWNLE
AAGSQMLDTYGSAGRQR
Download sequence
Identical sequences H3BW38
99883.ENSTNIP00000000200 ENSTNIP00000000200 ENSTNIP00000000200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]