SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000237 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000237
Domain Number 1 Region: 223-461
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-77
Family Eukaryotic proteases 0.0000033
Further Details:      
 
Domain Number 2 Region: 39-102
Classification Level Classification E-value
Superfamily GLA-domain 4.71e-24
Family GLA-domain 0.00023
Further Details:      
 
Domain Number 3 Region: 93-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000203
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 4 Region: 128-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000478
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000237   Gene: ENSTNIG00000006589   Transcript: ENSTNIT00000003876
Sequence length 474
Comment pep:known_by_projection chromosome:TETRAODON8:3:1189769:1192216:1 gene:ENSTNIG00000006589 transcript:ENSTNIT00000003876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QITVIINCLLKLTLQAMQAIFTAFLDKNNAAQVLSRRRRANSFLEELKQGNMERECNEER
CSLEEAREIFEDADKTNDFWAVYIDGDACKSIPCANNGRCKDGIGTYTCFCPTGYQGFNC
EIVIPQLCEKENGGCEHFCHVVRGNVQCSCAGGYSLASDDKSCHSSEKFRCGGIVQENTR
TVFLYDRQNTTTDGQNITSLINSTESFSKVSSDNQKEERIISEMAQKTRIVNGENCPPGE
CPWQAVLMNEDHRWFCGGTILNQYIILTAAHCMNETNYFYVKLGEFDMLVDEGNEAIHEV
ETILAHNKYLPDTYHNDIALIKLVTPITYSKFILPACIPEQEFAESVLMQQPDGMISGFG
RFRENRPTSNLQRLTIPYVDRRTCIESTSLRISTRMFCAGYDDIAKDACQGDSGGPHVTS
YRDTYFVTGIVSWGEGCARKGKYGVYTQVSKYIGWIHDGIKRLVPHEQSTRSKR
Download sequence
Identical sequences H3BW75
ENSTNIP00000000237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]