SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000250 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000250
Domain Number 1 Region: 448-573
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-31
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 238-361
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-30
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 348-452
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-24
Family Cadherin 0.0044
Further Details:      
 
Domain Number 4 Region: 135-242
Classification Level Classification E-value
Superfamily Cadherin-like 7.98e-20
Family Cadherin 0.013
Further Details:      
 
Domain Number 5 Region: 562-671
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-18
Family Cadherin 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000250
Domain Number - Region: 38-104
Classification Level Classification E-value
Superfamily Cadherin-like 0.000136
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000250   Gene: ENSTNIG00000005148   Transcript: ENSTNIT00000002356
Sequence length 967
Comment pep:novel chromosome:TETRAODON8:1:6694207:6798900:1 gene:ENSTNIG00000005148 transcript:ENSTNIT00000002356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVEHHFLKCSSMSKVLFFSSSLHFLLITLHFGVSFGEVRYVLPEEMQRGSVVGNVAADL
GLKVSELDARRARVVAEGSRQLCQLDTASGSLLISQRVDREELCAQAPVCVLQYQLLIED
PLQAFSIVLDITDINDNSPTFAAGEIQLDLVESTVLGSRFPLESAHDPDLGTNSVREYKL
SPSDHFALEINTQINGNAYPELVLKKALDREAQAEHVLKINGIDGGSPARTGTSSIHVRV
LDANDNVPVFSQRVYKAFVMENSDTGTVITRLNATDLDEGVYGEISYSFSRLSEKMGGVF
EIDPLTGEVRVAGLIDYEETSTHELDVQAKDGGGQASHCKLIIDVMDVNDNKPVIEIKSA
SANVAEDATPGTMVALVNVYDLDTGSSGRITCTIPDDVPFKFLSEVKNYYMLVTDEPLDR
EFQSEYNITITASDAGSPPLASVKILTIVVSDINDNPPTFAQKEYDASILENQPVGTFVM
NIKAVDLDGGSNAKILYHLSMDSNSETSSFLTINSETGALYTSRLFDYEQSVHFQMKVTA
YDGGSPQLSSTCALNVFIKDQNDNAPVVLYPVQTSGFVAEDMVPFEAPRGYLVTKVVAVD
ADSGHNAWLTYRVIKATRPNLFTVGMHTGEIRTVRAFQEDDETKHTVSVLVTDNGPESLS
ATATLSVIIGDGLPVLNEFFEFVDESQANDNITLYLIIALAVVSSLFILLITGLFYFKLC
RRPRYLYRSSSASLPVFPPTYCPPTLTDLSRCGTLLKDDRYDPFLTTGSWRGDFRFGSST
DTDTLKKRSAAYQKSTMRRASADRATLKARAGAPHPCYVFTQKPPNNDWRFTQGQRPGPS
GETGGTETECMDRPWPQPPTEAEQLQALMATANEVSEATANLGPGTMGLSTRYSPQFTLQ
HVPDYRQNVYIPGSTATLTSNPQQQQATAQQAAQQALPPPQASAQPEPPKAAQTPASKKK
STKKEKK
Download sequence
Identical sequences H3BW88
ENSTNIP00000000250 ENSTNIP00000003103 99883.ENSTNIP00000000250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]