SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000251 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000251
Domain Number 1 Region: 21-313
Classification Level Classification E-value
Superfamily L domain-like 5.16e-62
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 248-464
Classification Level Classification E-value
Superfamily L domain-like 3.16e-33
Family Internalin LRR domain 0.066
Further Details:      
 
Domain Number 3 Region: 55-79,529-817
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-26
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000251   Gene: ENSTNIG00000009409   Transcript: ENSTNIT00000003232
Sequence length 962
Comment pep:known_by_projection chromosome:TETRAODON8:5:7452530:7469319:-1 gene:ENSTNIG00000009409 transcript:ENSTNIT00000003232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCLWCFLRPGATGQGQSAAVCSPSCSCEDGGADCSGRGLTAVPAGLSAFTYYLDLSMNNI
TELPAFVFQNFPYLEELRLAGNDLSFIHPEALSGLHQLKVLMLQNNQLKTVPSRALKNLH
SLQSLRLDANHISAVPEDSFEGLQQLRHLWLDDNNLTEVPVGSLRHQANLQALTLALNRI
SYIPDSAFANLSSLVVLHLHNNRIKEIGDNCFAGLSNLETLDLNFNSLMVFPRAVQALPK
LKELGFHSNDISSIPEGAFHNNPLLRTIHLYDNPLSFVGASAFQNLSELHSLMLRGANMM
QDFPILTWTSNLESLRTLSGTKISSIPAELCEDLKLLRTLDLSYNRITEVPTLQACVRLQ
EINLQHNRIGLIDRDTFQGLSALRLLDLSRNEIRVIHKDAFLSLSALTNLDLSMNSLTLI
PTTGLSSLSQLKLAGNPQMKNVLSAKNLPRLRSISVPYAYQCCAFIGCDLSASASAELQV
KKSTAAASSSGWSSSSSGGSDVERISMLMHCSPSPGAFKPCEHLLGNWMIRLTVWFICLV
SLVFNSLVLVATFCPAPGGAGRCRPLPAARPVSPWRLLMGLLALANLLTGLYVAVLTVLD
AATWGSFAEFGVWWESGPGCQTAGVLALFSSEWSVLLLALAAVERRVPCRGERRFGLAAA
LLALLAATVACLPLLTSAERSASPLCLPFAGSESPTLSVTVFLVLLNTLAYLFTAGVYTQ
LYCHLGRVELADPEQTGALRHVAWLIFTNCIFFCPVAAFSFAPLLTGSTAGGLEIAKSVT
LIFFPLPACLNPVLYVFFSPAFREDWLRLRGRRGRSREAKARANSHGDDSGGASELTDAG
STAHLGFDCGVYSQLCGEALVCEQCEAALHARTCSSPSSSSICRHLLKSHSCPTLLAGGA
ACQRSGGFWADSGTPSAQSEYADEEDSFVSDSSDQVQACGRACFCQSRGLPLVHYSYNIP
RD
Download sequence
Identical sequences H3BW89
ENSTNIP00000000251 99883.ENSTNIP00000000251 ENSTNIP00000000251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]