SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000253 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000253
Domain Number 1 Region: 37-121,169-289,333-448,532-643
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-31
Family LacY-like proton/sugar symporter 0.063
Further Details:      
 
Domain Number 2 Region: 456-508
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000347
Family Ovomucoid domain III-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000253   Gene: ENSTNIG00000006848   Transcript: ENSTNIT00000001723
Sequence length 664
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:88403084:88409233:1 gene:ENSTNIG00000006848 transcript:ENSTNIT00000001723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSLWGQSNMGAEEPNPTGSQRPARRRSLFNSIKFFVLCHSLLQLAQLLVSGYMKSSIST
IERRYGLSSQKSGMLAAFNEVGNTVLIIFVSFFGSRVHRPRFIGGGALLACLASLLMALP
HFLSGPYEYTDHISHGKASIDNRSAVCQSESNLNIKPTNQSCSQQDNPAQHVAYPLLLLG
QLLLGIGVVPIQPFGISYIDDHASKRNSPLYLGLLLAATAIGPAFGFITGSIMQRFYVDF
DKVSKDHIHLTPKDLRWVGAWWLGFLVASCLIFITALPYFFFPRSMPKEWHTLPFHLLST
CGATANEDADDVESSPDCTKQRPDPIQELSLLQFLKSFPHVALRMMRTPIYLLVILAQVN
QAALLAGLATFMAKFIEKQFNRTASLSTMMIGGVCIPLAVVGTVLGGVVMRRLNLSLNGA
SKLCAGAIFVCLFSSLPLLLIGCSTQTVDGVFPPGSGSLSCSASCHCPEEAFNPVCGSNR
VEFRSPCHAGCNNIQFGPHNQPINFTDCKCVGGLGFASPGTCGSGCSHLLLPFMVLLAIT
SFVTSFTQTPSFMMILRTVPAEDKSFAVGVQYMMFRVLAFLPGPVLYGSVIDTTCILWGK
KCGQQTSCLYYNLDQFRSRFLGLMAVFVGGALLSFLLTVRVLHRGAKENASTPGSKGGYE
LVNE
Download sequence
Identical sequences H3BW91
ENSTNIP00000000253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]