SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000286 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000286
Domain Number 1 Region: 18-158
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.01e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00048
Further Details:      
 
Domain Number 2 Region: 132-318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.2e-40
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 953-1165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-33
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 4 Region: 343-534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.06e-33
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 5 Region: 553-575,778-943
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-29
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 6 Region: 561-618
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000673
Family Fibrinogen C-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000286   Gene: ENSTNIG00000018132   Transcript: ENSTNIT00000000104
Sequence length 1301
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:22515186:22525234:1 gene:ENSTNIG00000018132 transcript:ENSTNIT00000000104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQYFFLPGKCENSLATPLPYSSFTSSSVYAGGYGAGFAKLKRKQGAGGWSPVDTDHYQWL
QVDLGSRKEIVAVATQGRYSSSDWTRKYQLIYSDTPKNWRPYLQDGNIWTFEGNINSEGV
VRHELQHAILARYIRLIPVDWSREGRIGVRLELYGCSYWADVISFDGHGVISYRFRSKKM
KILKDVISLKFRTTSEDGVLLHGEGQQGDYISLELRRARLQLSINLGSNQYGSIQGHTTV
TSGSLLDDDHWHSVVIERYRRNVNFTLDHHTQRFRTNGEFDHLDLDYEISFGGMPLSLKP
SSGGRDNFVGCMEGITYNNDNITNMVRRKKVDTSSFRNLTFSCAESNSFSVFFNSTSFLK
LPGQSDSDTLSVSLSFRTWNPSGLLMFTTLADGWVEVGLSEGKVIVYVTLTQTKTTRIDI
SSGSGLNDGQWHSVHLNVLENHAMLTVDGDEASTVRTAIPVQIQTGGTYYFGGDTHEDGY
FLHTNTRSPQRSFQGCMQMIHIDDHLADLRAVEQGLIGTFENVSLDMCAIIDRCFPNPCE
HGGYCSQTWDMFTCNCSGTGYAGATCHTSMYQQSCEEYKHQGRSSGSYWIDPDGSGPVAA
FEVTCDMTGETVWTKLKNNVSPQTPVMSTEENGKAVLQVTYNVSDEQMLSVTSSAEYCEQ
YVAYACRMSRLLNSPDGVPFTWWVGRANERHSYWGGSGPGIQKCSCGIEHNCTDPKRYCN
CDADLRAWREDAGLLVYKDHLPVNQVVVGDANRGGSEAKLTVGSLRCRGDWNFWNAASFS
SPASYLHFASFRGETSTDISFYFKTSSTHGVFLENLGLNDLLHIELKGGSVVLFSFDAGD
ERVELSVRSPQPLNDDKWHRVEVEKNIQEAALQLDGQYREVRPASPQGRTKLEFYSDLYV
VYIPGASSGQRGFLGCMRALKINGVTFNLKAKAETSPGVSPGCQGHCSSYGTHCRNGGTC
VEKYNGYSCDCSLTAYDGAFCTEDVGGYFETGTLVRYDFPPEAANFALPETKSQAGVGLL
HGANLTQEELVFSFSTSSTPSILVYVSSRTQDYMAVVLKHNGTLQIRYSLGGLAEPYTID
LHQRNMANGQPHSVNVSRNQREIRLQLDHYPVSTYTLPEESDTQFNLVKSIFLGKVFETG
QIDPVLIERYNTPGFVGCLSRVQFNSVAPLKAALRSGQGAPGSAKGILVPSNCGASPLTI
SPMASAADPLALRSFRLRNRKMNLMPHVSDAPLPPGIISMVIFTVLCIMVFVVRHLFRHK
GSYHTNEAKGADAADCADAAIIVSDPAFTETIEESKKEWFI
Download sequence
Identical sequences H3BWC4
ENSTNIP00000000286 ENSTNIP00000000286 99883.ENSTNIP00000000286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]