SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000295 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000000295
Domain Number - Region: 92-139
Classification Level Classification E-value
Superfamily PX domain 0.00294
Family PX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000295   Gene: ENSTNIG00000000864   Transcript: ENSTNIT00000003676
Sequence length 193
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:69956160:69958184:-1 gene:ENSTNIG00000000864 transcript:ENSTNIT00000003676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLHPAFHFHQGEKFREQLDKLEAPNRFRVDAQVRPLTSGHTPRQGLRNLASADKSLSC
NTMIIPCSQKLCEHALFLFPWICSCPAMHIEEIVLRSVTRTTIEKEYNFQVKWSDSSSSY
VTKTHLELENFLLKLPKNNCSEGFEKSILRLLNKAEEADSCEVEEILREKFLSAPSAFKQ
IRKVCSFFSCGSS
Download sequence
Identical sequences H3BWD3
ENSTNIP00000000295 99883.ENSTNIP00000000295 ENSTNIP00000000295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]