SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000307 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000307
Domain Number 1 Region: 444-669
Classification Level Classification E-value
Superfamily vWA-like 3.02e-61
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 16-204
Classification Level Classification E-value
Superfamily vWA-like 3.14e-55
Family Integrin A (or I) domain 0.00027
Further Details:      
 
Domain Number 3 Region: 360-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8e-16
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 4 Region: 204-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000636
Family EGF-type module 0.027
Further Details:      
 
Domain Number 5 Region: 238-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 678-723
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000000536
Family Chicken cartilage matrix protein 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000307   Gene: ENSTNIG00000005220   Transcript: ENSTNIT00000000167
Sequence length 724
Comment pep:known_by_projection chromosome:TETRAODON8:11:11916341:11920148:-1 gene:ENSTNIG00000005220 transcript:ENSTNIT00000000167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAALRLPPSPGPEQKCRSGPVDLLFLIDSSRSVRPHEFETMRRFMIDILNTLDIGLNSTR
VGVVQYSSQVRSEFSLRSHASLDSMVKAIQEMVPLAQGTMTGLAIRYTMNVAFTAAEGDR
PKVPNVVVIVTDGRPQDRVAEVAAEARERGMEIYAVGVARADMTSLRAMASPPFEDHVFL
VESFDLIHQFGLQFQDKLCGADLCVESDHGCEQVCESSPGSFRCLCLPGFTLNHDGKTCS
AIDLCSEGKHDCQQICVSSPGSFTCGCGPGFRLNQDQKTCTNITSPSNRQQPLATPTSAP
LLKLAVFLAMTESELRNRSLCASRRLTEACNANVATGVYLHTSKLQRQKCTFSAPPSVID
YCSHGNHSCDHECVSVLSGYHCQCNHGYRLLDNGWTCRAIDLCSEGKHDCQQICVSSPGS
FTCGCGPGFRLNQDQKTCTDVDLCNSLDHGCEHQCVNTPGSFYCACADGRSLQEDGKSCG
TCKSANIDLVLLIDGSKSVRPQNFELVKKFVNQVVDSLDVSPQGTRVGLVQYSSRVRTEF
PLSMYHSAQEIKAAVMKVEYMEKGTMTGLALKHMLENSFSEAEGARPARRHVPRIGLVFT
DGRSQDDISEHARKAKEAGITMYAVGVGKAVEEELREIASDPVEKHSYYSADFTTISTIA
ENLKLNVCPEESQGELEVKDPCACDRLVEFQQATMSSLEQLGALTRGPLAGMTSRLEQLE
KQLL
Download sequence
Identical sequences H3BWE5
ENSTNIP00000000307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]