SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000318 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000318
Domain Number 1 Region: 1203-1244,1319-1482
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000000136
Family NHL repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 609-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000426
Family EGF-type module 0.037
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000318
Domain Number - Region: 739-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000137
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 709-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 642-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00114
Family Integrin beta EGF-like domains 0.086
Further Details:      
 
Domain Number - Region: 575-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 769-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 676-702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0685
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000318   Gene: ENSTNIG00000019040   Transcript: ENSTNIT00000000592
Sequence length 2724
Comment pep:known_by_projection chromosome:TETRAODON8:16:5682465:5751760:-1 gene:ENSTNIG00000019040 transcript:ENSTNIT00000000592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKERRPYRSLTARQDTEHRYTSSSADSEDGKANPKSYSSSETLKAFDHDSRMAYGSRD
SLSSGVDFSLRNLGFGEALPSHVATYRSDMGLPHRDYSVSAGSDPDTETDGIMSPEHAVR
LWGRSNTKSGRSSCLSSRANSNLTLTDTEHENTENGRPASTSVHPSMLIVHQPLDSIRLI
KNTPYTQHTFFVGRPPPPPPNACQRMTENPSSINSLNRSNYTQRSNPSPAPTDSSVPPEG
PASQDSVSVQDNWLLNSNIPLETRQFLFKPGGTSPMYCTTSPGYPLTSSTVYSPPPRPLP
RNTFSRPAFSLKKPYKHCNWKCAALSAILISVMLLFLLAYFIAMHLFGLNWHLQPVQRQM
YQLSEDNTSGLPFPTDLSVSPVGNTGLVIPERRGKLDSLFPDDSYIDMGEIDVGRKVTQQ
IPPGVFWRSQVFIDHPMYVKFNVSLSKDALVGIYGRRGLPPSHTQQFDFVELLDGRRLLV
QDIRGVEGPAAMQRGLIPITTHDTGFIQYMDSGIWHLAIYNDGKETETVSFLTTATDSID
DCPSNCFMNGDCIAGKCHCFLGFKGPDCGRAACPVLCSGNGQYLKGRCMCHSGWKGSECD
VPTNQCIDIACSNHGTCIVGTCICNPGYKGENCEEVDCMDPTCSGRGVCVQGECHCFVGW
GGSGCESPRASCMDQCSGHGAFLADTGTCSCDPNWTGHDCSTEICAADCGGHGVCVSGSC
RCDDGWMGSGCDQRACHPRCNEHGTCKDGKCECSPGWNGEHCTIAHYLDKVAEGCPGLCN
GNGRCTLGNNGWYCVCQLGWRGTGCDTSMETACTDVKDNDGDGLVDCMDPDCCLQATCHT
TALCVGSPDPLDIIQETQLSSTQSKLQTFYERVRFLVGRDSTHVIPGVNPFDGKQTNCAA
VRQIVREDDSPSLKRFSFLMFPFSLSLFIFNHFFDLVTNGGIAVALHFERAPFITQEHTL
WLPWGRFFVMDTIVMRHEENDIPSCDVSSFSRPSPLVSPASLTAFAGSCSERRSVVPEIQ
EEESANTQESDMKFSYLSSRTAGYKSLLRVTLTHSTIPFNLMKVHLMVAVEGRLFRKWFP
AAPNLSYDFVWDKADVYSQKVYGLSEVFVSVGFEYESCPDFILWEKRAAVLQGYETTASK
LGGWTVDKHHALNIQSGILHMGNGENVFISQQPPVIGSVMGNGRRRSISCPSCNGLADGN
KLLAPVALACGSDGSLYVGDFNYVRRIFTTGNVTSVLELRNKDFRPIGKKHSIYLNKYRK
SVYCAETNTLELYTDLQSMLKPANLSLNAKAWKKNIEMCLPLNKKSHCVELTKYLLLSMN
ETAGITVDKYGVIFFVDGTMIRRIDQNGIISTLLGFNDLTSARPLSCDAVMDISQVRLEW
PTDLAVSPLDNSLYVLDNNVVLQISENHQVRIVAGRPIHCQVPGIDHFIMSKVAIHATLE
SANALAVSHTGILYIAESDEKKINRVRQVSTNGEIFLVAGAPSGCDCNVPRENMLNGYHS
KRLSDAVFNLSRSPSPVFELESVAFLKVRSVEQVINYYYELHLFVVPAKKERVFSFHING
SELTVNVFTHEAICTVSINTLATLILAEGLNCNGVHVVWSIHSLPFWNIGSQKYLRVFCA
EEIIRFFFSSGSFVMCVSFNISLMLTSCYKVYDSYGRLTNVTYPTGQVSSYRTDADSSVR
IQTEGSNKENITVTTNLSASGTFYTLMQDQVRNSYFIGLDGSLRLVLANGMEVSLHTEPH
LLAGTIIPTVSKRNITLAIDNGLNLVEWRQRKEQARGQVTVYGRRLRVHNRNLLSLDFDR
ITRTEKVYDDHRKFTLRIHYDHAGRPTLWAPSSRLNGVNVTYSPGGNVAGIQRGTMSVRM
EYDQTGRITSQIFADGKSWTYTYLEKSMVLLLYSQRQYIFEFDKNDRLSSVTMPNVARHT
LETSRSIGYYRTTYQPPEGNASVLQDYSEEGQLLQTTYLGTGRRVTYKYGKIAKLLEMLY
DTTRIGFYYDELTGMLKTVNLQSEGFTCTVRYRQIGPLIDRQIFRFSEEGMVNARLDYVY
DNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHF
DAYGRVKEVQYEIFRSLMYWMMVQYDNMGRVVAKELKVGPYANTTRYTYEYDADGQLQVV
SINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDNRDRITRLGDVQYRMDEDGFLKQRG
NDYFEYNSAGLLVRVYNKVSGWSIQYRYDGLGRRVSSRSSIGHHLQFFYADLSSPTRITH
MYNHSSSEIASLYYDLQGHLFAMELSSGDEFYVACDNIGTPLAVFSGAGIMIKQILHTAF
GEVYLDTNPSFQLIIGYQGGLYEPLSRLVHMGKRDYDVLAGRWTTPNLEIWKRLNSKHIA
PFNMYMFKNNNPLSNNEEIKCYMTDVNSWLVTFGFQLYNVIPGYHKPNTESMEPSYELVR
TQIKTQEWDSTKSLLGVQCEVQRQLKAFVKLERFGQIYGAKSAGCPQTETKHIFATMGSI
FGKGVKFAIREGRVSTDIISLANEDGRRMAAVLNDAFYLEHLHFTVAGMDTHYFVKMGPV
EGDLSLIGMTVGQRTLETGVNVTVSQVNAVLNGRTRRITDIQLQYGTLYLNTRYGSSVDE
EKARILEMARQRAVTQAWARERQRLRDGEEGSRTWTEGEKQQLLGSGKVQGYDGYYVVSV
DQYPELADSVNNIHFMRQTEMGRR
Download sequence
Identical sequences H3BWF6
ENSTNIP00000000318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]