SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000332 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000332
Domain Number 1 Region: 866-925
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000705
Family UBA domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1452-1528
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000149
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000332   Gene: ENSTNIG00000005273   Transcript: ENSTNIT00000001024
Sequence length 1628
Comment pep:known_by_projection chromosome:TETRAODON8:3:9055234:9064087:-1 gene:ENSTNIG00000005273 transcript:ENSTNIT00000001024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGQGAQYDNPHWGPPPSNRSATSAASSTSLGDWDQLIIDQRDTEAWPLIKLSPSQASPGG
CSLDTDPGPLTSSGSTSNSCSAVNMATGANSQTGHFPANHLSNKANSGLNHTNHTGTSML
SNQVAANRSWGSGPGPSHCPSQSSVGTEVKNDSPVGAGSSRGWGASSSSSAANFNLNLNP
NANPSAWPMLGHEGGGTGGGSSGGANSISPPQSTSNSCNTNTISSGIGSAWGNIMASDTL
EPHPSPSTNVSFSSEPQNLKTDGPNHTKQEPHSPIHHLSSWGNAPAGLGSMSQPSPGGPQ
VNGEDGSSVWGLSGDSKTPTSKETPAWDSGWSHGGNGGGNSGGWSEQSGGGWGKQHSEEA
QAGWDTPSSPPQELQSSPWSRAVSTTGASEGSSDSMESHPRRRDHTSRDNPVPLIPAQDL
DPRVLCNTGWGQTPVRQHTSWDMDDAKSKKDVDTESWGSGSTASNDAHGPSNTNMGPSQR
TEGASGWGGSIAATNQSNSSWSESPTNIKPTGGTGGWSTPPTGGPASSIPKNGAQSWGEK
STGWGTSGGSNNGREWREPEESKKNPNNSSWEGEAGGWKEIPRGWGMSSSGTGVSGAGGN
AGWGEPTGQRPSATSQGWGGKSQDGPTISSGGEGMGSWSGPGTVKQGAGWSGIKQDSSSE
PTGWEEPSPTSIRRKMEIDDGTSAWGDPGTYNKAVNLWDRNNSGMSQTKVNTGGNNPQGS
NNNNHHPPSHHQSGPSHSRGPLAAQGHSGWGEIPSSHTKSESSWGDPAPSPVTVDNGTSA
WGKPTGGCSSWGDSNPGMAPTSCKPAPKPMQDGWGGGGDEMNLSGGQWDAEDGDMWNSAA
SQESNSSCNSWGNASKKIAQKGKVPGKQEDTWIMNRLIKQLTDMGFPRDPAEEALKSNNM
NLDQAMSALLEKKTELDKRGMAITGHDYNSGLINKPMNCPRPPLLSKDPSADPRLPFMDK
VNHFGFFTAAQDIISFSLARYIKSYITIFIISQVIYFNFLLITRFFSIQQMQSGMFGGGG
AEQVRAVQQAQSLQPPVPLFNFSQPSLRVQVTQFFSLQVQAQLLQFAAKNIGLNPALLTT
PINPQHMTLLNQLYQLQLAYQRLQIQQQMLQAQRNVSGPIRQQEQQVARTISNMQQQIQQ
HQRQLAQALLMKQQQQQPPPSHSGLHPSGAKSTLDSFPGHPQAPGFPDMQTKEPQSSPNT
YSSYSLAGMNPNMNVNCMEVGGLAMKEPPQPQSRLSQWTHPHSMESLSGNSSPLEPNLGK
HGANLCPPGKPHQLEDSYSPYSLMPSSDSPSSPLVPPDNWGQGKSSSDKMANGTNINWPP
EFCPGVPWKGLQNIDPETDPNVTPGSVPSGPTINTTIQDVNRYLLRDRSGGKLSEMKSTW
SPGPISHSQASLSHDLWKVPQAPRSANTAPSRPPPGLTNTKPASTWGGTSLGLAQGWSSS
YTTAGTTWSTDSSTRTSSWLVLRNLTPQIDGSTLRTLCMQHGPLITFHLNLTQGSAVVRY
SSKDEAAKAQKSLHMCVLGNTTILAEFAGEEEVNRFFAQGQLLGGTTSWQATPGTNQTRM
GGASSGAAHPIGHSSHWTAKTGGELLWGGVQQYSSLWRPPSAEEGRVMGSPTPINTLLPG
DLLSGESM
Download sequence
Identical sequences H3BWH0
99883.ENSTNIP00000000332 ENSTNIP00000000332 ENSTNIP00000000332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]