SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000347 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000347
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-50
Family SPRY domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000347   Gene: ENSTNIG00000000482   Transcript: ENSTNIT00000004155
Sequence length 170
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:14507671:14508180:1 gene:ENSTNIG00000000482 transcript:ENSTNIT00000004155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDQETAHKRIMVSDGFTKATMADEPLNYPDSPRRFTVCSQVLASKGFTRGRHYWEVQLSS
NNFIGIGLTYHDIERKGLTSRLGRNAVSWCVEWLNNKLSAWHNSHETVLENPYPSCVGVL
LDGDRGIATFYNVSDKAVPFHSFVFPFTKAVYPAFWIFPSGSSMSLRRLQ
Download sequence
Identical sequences H3BWI5
ENSTNIP00000000347 ENSTNIP00000000347 99883.ENSTNIP00000000347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]