SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000367 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000367
Domain Number 1 Region: 61-276
Classification Level Classification E-value
Superfamily GFP-like 8.06e-61
Family Domain G2 of nidogen-1 0.0053
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 381-508
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 470-601
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000104
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 299-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 336-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000703
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000367   Gene: ENSTNIG00000013414   Transcript: ENSTNIT00000003951
Sequence length 716
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:31542681:31548177:1 gene:ENSTNIG00000013414 transcript:ENSTNIT00000003951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVNGGYSSWKEWGPCSSTCGQGFQERTRLCNNPEPANGGRSCSGPSSDSRKCHVGLCPGE
SPRKTRGSLIGMVNEREFGVSSLEATISDSEEEDGSNLLQARLDNIPPSVGPLMRALVSV
FAPIYWTTVLQRGAARNGYSFTHGQFRQESQLEFDTGEILRVTHVARGLDSEGVLLLDIV
INGFVPPSLASSLLSLQGFNESYMQTGQGQFYSWSSQTHRRGGAPMVLRCNHTIIYEGQE
ERQGPLLQLLRLSEIDSVYNMLTLSLEFHITASLHVADGYEDSCPEGFTLDQTYCAELDE
DECALRSPCSHSCNNIMGGFSCSCPSGFTISTVSNTCQDVDECSQGLHMCHYKQQCVNTA
GAYRCQAKCGAGFKPSVTGTGCEDVDECQESSISPCHHQCLNSLGSFRCVCHPGYQLSGR
RCLDINECMRNVCPANKECRNTDGGYQCFDSCPAGMTKAETGACVDIDECHDGSHMCRYT
QICQNTVGGYGCICPRGYRSQGIGFPCLDVDECQLRRPCQHECRNTVGSFHCLCPPGYQL
LPNGRNCKDIDECVEQGVQCGHNQMCFNTRGGYQCMDTPCPASYQRGGSPGTCYRACYRD
CPAGGSTLLLQYKLLTLPSGIPAHHNVVRLSAFSESGVLQDRTSFVILEQESESGVPGRV
FGIRDEAGRGIIFTVQALDRPGLVRLKVQATTISPQGRITYQSIFIIYISISAYPY
Download sequence
Identical sequences H3BWK5
ENSTNIP00000000367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]