SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000387 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000387
Domain Number 1 Region: 101-303
Classification Level Classification E-value
Superfamily vWA-like 7.93e-54
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 311-337
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000575
Family Chicken cartilage matrix protein 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000387   Gene: ENSTNIG00000003118   Transcript: ENSTNIT00000003592
Sequence length 356
Comment pep:known_by_projection chromosome:TETRAODON8:14:4255838:4258916:1 gene:ENSTNIG00000003118 transcript:ENSTNIT00000003592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HYRYQPPGIPPPVVYRPFLLSPPKPKASCPKNLVPTFSSAPVAPLPTIPSPPNPTVQLTT
PPAPLATITPEVLPVETSAPATLSVSTFTTTVSAVETGPGCLNVPLEPSTTKTDSSCLSR
PLDLVFIIDSSRSVRPSEFEKVKIFLADMVDTLDVGADATRVAVVNYASTVKTEFLLKDH
FNKPNLKKAISRIEPLATGTMTGLAIKTAVSEAFTEQSGARPRPRNIAKVAIIVTDGRPQ
DQVEEVSAAARASGVEIYAVGVDRADMRSLQLMASVPLEDHVFYVETYGVIEKLTSKFRE
TLCVKEVKVEVVEDPCKCEARLSFQKQTQATIQQLTARNILPVVSDKNSSSDHRRV
Download sequence
Identical sequences H3BWM5
ENSTNIP00000000387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]