SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000406 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000406
Domain Number 1 Region: 484-629
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-36
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 188-288
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-17
Family PDZ domain 0.024
Further Details:      
 
Domain Number 3 Region: 8-60
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000381
Family SAM (sterile alpha motif) domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000406   Gene: ENSTNIG00000013626   Transcript: ENSTNIT00000003822
Sequence length 981
Comment pep:known_by_projection chromosome:TETRAODON8:6:6710734:6726138:1 gene:ENSTNIG00000013626 transcript:ENSTNIT00000003822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEGLDDCLQQYVCVFERGVCGERLLRISHAELEELGVSRIGHQELILEAVDLLCALNSGL
ETESVRTLAHKLGASAKNLQNFISSRRRSSQSESRSSRRLPNDLLTSVVDLITAAKSLLA
CRWTVPPRSPFAAVADYSVTRNNVIQLCLELTTIVQRDDCTVFETENKILHVCKTLSEVC
EHIVCVSSDPLVSQSAHLELVHLTNIKPSEGLGMYIKSTYDGLHVITGTTEGSPADRCKK
IHAGDEVIQVNHQTVVGWQLRNLVGSLRADKGVVSLTLKKRPQSTLSSTPAMLKNMRWKP
LALQPTKSPGSGSATPSGTPTKNSALQDLHIPPPPSEPYTPRDEPGALSGDEASRNHGGA
SVSKRSDSPNSFLDQETRRREEEEPVYCTTPTYGRLRPISMPVECNWAGDYEDPGKMNRE
NRREASLMRYAALSTVDDRTASEEYSSHTARLGKRSNNTAKRAKRRSHHSQSPSHYVLQA
NQRDSPPRDPTPIYHTYQQSSSLQSKTRKKNKGRALASLSRRRVSCKALGRGDCEGWLWR
KRDAKGYFSQKWKKYWFVLKDNCLYWYINEEDEKAEGFVSLPEFKIDRASECRKKYAFKA
CHPKVKSFYFAADGVDDMNRWLSRLNMAAVGYAERERIRQEQDYWSESEHEEDTTASPKQ
DSPPPPYDTYPRPPSMSAYVEGRTTRLSSTETSRSRSSQEDFYRSSPAGGSSETGSPGRS
SSSQRRSWQDLIETPLTEAGLHYLQTGPLEDAVFAEPGPGGGSMMAGAVYTLPAQRNVPL
PVAMQRLIPMATQGGKPRSFTLPRDSNLHSLLVPPAKEEQQPRNGRPPETEGGFSFEACW
RRCRNVAEIKEKLSESEGASLGDLFRACEQGGVCPLGRAPEGRGQSEFRQSFLRRAEDPQ
LNERLHRLRILTSTLKDREGELALIDRLLANPQLSSAEFQEWKQAYQELFCQEPEPTSES
DTGPPLTPSLSHTHSYIETHV
Download sequence
Identical sequences H3BWP3
ENSTNIP00000000406 ENSTNIP00000000406 99883.ENSTNIP00000000406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]