SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000410 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000410
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily BPTI-like 7.38e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0018
Further Details:      
 
Domain Number 2 Region: 73-129
Classification Level Classification E-value
Superfamily BPTI-like 1.29e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 3 Region: 187-222
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000184
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000410   Gene: ENSTNIG00000001103   Transcript: ENSTNIT00000000373
Sequence length 256
Comment pep:known_by_projection chromosome:TETRAODON8:2:19014199:19021322:-1 gene:ENSTNIG00000001103 transcript:ENSTNIT00000000373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFNELCALKDEQGPCKAIKDRFFFNVDNGRCEQFEYGGCGGNANNFETLEECEETCVVSV
LCSLLEISLQKNNKTPCHLSEAPGPCRGLLSRYFYDSRSQQCKHFFYGGCFGNANNFRSM
AECQAKCQSPGRSGCLDVALMTLKASNRNLIEKPTEEPVLSDKHNPQSELTSFVNPGSAA
NNDSEIKYNSVTKRCQAFYYSGCGGNENNFARRRSCIAKCIKGQREFFFRGILETHAKER
EKVLKASVQFIVYINI
Download sequence
Identical sequences H3BWP7
ENSTNIP00000000410 99883.ENSTNIP00000000410 ENSTNIP00000000410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]