SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000418 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000418
Domain Number 1 Region: 11-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.83e-55
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 705-811
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000199
Family Myosin rod fragments 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000418
Domain Number - Region: 404-497
Classification Level Classification E-value
Superfamily Tropomyosin 0.00556
Family Tropomyosin 0.0095
Further Details:      
 
Domain Number - Region: 1165-1330
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number - Region: 601-697
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0706
Family Myosin rod fragments 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000418   Gene: ENSTNIG00000009552   Transcript: ENSTNIT00000000364
Sequence length 1370
Comment pep:known_by_projection chromosome:TETRAODON8:5:10400377:10411897:1 gene:ENSTNIG00000009552 transcript:ENSTNIT00000000364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNTDWNKYDDRLMKAVERGEVDKVAAVLSKKGVVPTKLDVEGRSAFHLAATRGHLDCLNL
ILAHNVDVTATDASGKNALHLSSRNGHSQCVQKLLQHNCPVGNVDLQGRIALHDAVMAGC
SSSVKLLCDSGAAVNATDFDGRTPLVLATQMCHPRICQLLLERGADITIRDKQNKTALIL
GCEYGCKDAVEVLLKSGADVKAVDSLGHDAFHYARLSKNTELVALVKTHLDKITRDKETA
KMEQWKHQQSVERFESLESNRRDQIIHDLERQNETLQESLKKYHQEQRALIDKVNLLQQQ
LTQEKLTVEGAQKEKEQLKGLLVAKDGEEGARGSETVKVQLRSTLGDYSGQSVIKGKENV
LVKQAHSLDSDHVSLTHFYPNFEQIVQKLSVSRPGDKSQPTVGWDVSGELNTLRQEHEAV
KRKQHAAEEEVARLQSALNRKNRECQELVQSRDAIQKQADQQIHELEEALGDVQKRMLDS
ECKVKQLQAHVVAVKEHLGGQGVEDLRLQLQDVKAKYEGASAEVGRVRNRLKQSEKALEE
YKSSESQLAAEAERLGQDLDVVVAERDELAEVLVVMEAKLKEADTKHGSMVPAEKFDNMK
NLLTNAVDEKERQLAELREDYDRVLEEVADLNRKMDGPPSQTSAEEQQRLRASLEGQNDS
LKQKLLELTAKSQDLICEVKEGKEERSILLEQLNEFRTRIEMDFIPIRDYEEARKSMVMA
LEELEDKLVEASERYGKAEAQVQQLQAERTQLQENISSIQSSSKTHQSQLDELSSHNCDL
LKKIELMQRQSEDGKKERVQLNARIQTLEKSLAAEYVPRQQHENVKAELGSALESARAET
LQTQKEKKASEEELTKVKDGNDRLKEELEKLSQEMKDDRIHVKEHKDATEKLKATVAEAE
TKVKEVTALYLSAQEETVKLTQELEAQKKELDTIQQAIQSKFISVAAAEEKQKAHLVQVA
DLQNKLAEMEAEYTKEKCAGQSNKQEQEKLKVEMESVQQRLDSALVTSERHRDVEEEFKS
RCDQLTHKLSSLEQQHQELLLQKADLHEQNALCRTQNQNLQDRLKAELTRIATYDSELKA
LHDAMQQAQTDCKKAREARQEEAQKVGALQKELQEQRRDQASLLQQQAQSEERLEAEMAE
ISRLRLALREEEENSAQRAEDVSALQSELLQATQALEKVRYKEEQMNQMKKEKQELEKEV
TDLSSKLLGVADQCKEAQQEAARAREKESKEKGNTIEGEIGELKKRYDESLSTIGDLQRR
IQTSAQQTEAKDKKITELLTDVERLKQALSGLSQLAYTSNTPSKRQAQHTDAMQAQIRSL
QQQLADAERQHREVVSIYRTHLLSAAQGHMDEDVQAALLQIIRMRQELVC
Download sequence
Identical sequences H3BWQ5
ENSTNIP00000000418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]