SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000465 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000465
Domain Number 1 Region: 232-397
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000089
Family Integrin A (or I) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000465   Gene: ENSTNIG00000004494   Transcript: ENSTNIT00000001455
Sequence length 990
Comment pep:known_by_projection chromosome:TETRAODON8:13:13185380:13198675:-1 gene:ENSTNIG00000004494 transcript:ENSTNIT00000001455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQQWASEFSVQLRDLTVKYSGSLLLQKKLKDVESIIKIVELNGDDLVRDYSNEIERMLGS
KMKSVKRLAESAEDADLYHEFNASLEFDYYNSMLINTVDEDGNSLELGAEFPLEENEHFN
NIPVNTQQSNIQVPTNVYNKDPIILNAIYNTEALNDVFISNFLKDPTLTWQYFGSSTGFF
RIYPGIKWTPDPNGVVVFDCRNRNWCIKAIFCISDLKIIINRPHFKKMQFKTTIAKHTIN
TILDTLGENDFVNIIAYTDYVRYVEPCFKGTLVQADLDTREHFKLLVDELHVKGEAKIKN
ALKEAFKILNQVRVNGQGSMCNQAIMLITDGAMEDFESVFEEFNWPDRRVRVFTYLIGRE
MTFAQNTKWIACNNKGYYTHISTLADVQENVMEYLHVLSRPMVINHDHDIIWTEAYMDTV
LPNTKQLFTTKAQSLLLMTSVAMPVFSKKKETLSHGILLGVVGSDIPLMEVIKLAPRYTL
GPHGYAFLITNNGYILAHPDLRPLYKDGKKLKAKPNYNSVDLTEVEWEDTEDTLRTAMVK
GQTGSLSLSVRASVDKAKRPLFLINEYFYTNIDDTPFSFGMVLTKGHGKLFFIGNVSVEE
GLHDLTSPDLSIASEWTYCETDIDPSHRKYSQLQAAVRYLQGKEPDLECDEVLLQQLLFD
AVVTAPLEAYWNTLMLSDRVEPGVETAFLGTRSGLMRVVRYAGVEARVAKNFLTPSDKDN
LFTIHFPLWYRFGSLKYYPGSTSTTLSSRKAREVRGARNVQGQLMRCAGVRSAGVTLELY
LCRPHLWLAPRKDSRRGGALRCSCRSPTRASKVTLSRAAILLLARDSQQASGQPQEAVVG
QVQPSQLPQSVEGFPGQALASDPDAAAGLAHSQLEHPFVAVAALMRWFFSNTLTLLMDLN
LCGLWHQLFVDGHKQKKMEAMIPCDTTYPGFMLEASVREANSVIKCGRCQKMFVVQQIPD
SNLVLVVTQADCDCSRQFGPIPLTPKEIKY
Download sequence
Identical sequences H3BWV2
99883.ENSTNIP00000000465 ENSTNIP00000000465 ENSTNIP00000000465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]