SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000527 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000527
Domain Number 1 Region: 378-558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-48
Family SPRY domain 0.00037
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 1.94e-21
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000527
Domain Number - Region: 209-299
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000527   Gene: ENSTNIG00000018810   Transcript: ENSTNIT00000000814
Sequence length 559
Comment pep:novel chromosome:TETRAODON8:18:10652048:10655727:1 gene:ENSTNIG00000018810 transcript:ENSTNIT00000000814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHASISVTESQFRCPVCLDVLKEPVSTPCGHTYCMSCLNNYWDQAEPGQVSCPQCREIF
SPRPVLRRNTVLAEVVDKLRLGGTVAAPELSAEPANVPCDFCPAESQLRAARSCLVCLAS
FCELHVVPHREVGTLRRHKLVAAVQRLPERLCAQHRLGLQPAGGSEADAAGEWSGDCLLC
EADQEERRSVDAQRARRQLQLGETQRIIQERTRRGERELEEVQQSLESLKVSASAVLEDS
EAVFADISARLEKTRAEVRARLEAKERAVVGQTERHMETLEKDLEELRRRDQEISQVLQS
GDSAHFSQVSWRKRGAPGGWGMCFRVSFSGAATTSWIRRALSRLRSRMEEVCREEVDHYY
CWKINSSYCVDEPADQRMRAVFLRCVCRLSLDPDTAHPTLVLLEGGQVPTVARSQSYPPH
QQRFDSVAQVLCREGQFGDASYWEVEWRGGGWADIGVTYRGIGRKGGGKPCLLGRNENSW
RLRCTHAGYAAWHDNRKTTVAAPVCPRIGVFLERHKGTLSFYSISDTVVLLHTFRCPFSQ
PLYPAFRLDLDSTLVICPP
Download sequence
Identical sequences H3BX14
ENSTNIP00000000527 99883.ENSTNIP00000000527 ENSTNIP00000000527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]