SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000583 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000583
Domain Number 1 Region: 25-347
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.16e-115
Family Bee venom hyaluronidase 0.00000975
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000583
Domain Number - Region: 411-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.024
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000583   Gene: ENSTNIG00000000981   Transcript: ENSTNIT00000002654
Sequence length 456
Comment pep:known_by_projection chromosome:TETRAODON8:13:13039535:13041462:-1 gene:ENSTNIG00000000981 transcript:ENSTNIT00000002654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWLLLLLHAASGHKAARLPLIGRKPFIAAWNAPLDRCTTRYNISTNVERLFHIQGSPRAE
WTGQNITIFYANRLGFYPHYTPQGVAVNGGLPQNCSLDLHLLKAHQDIRRFIPARDVRGL
AVIDWEFWRPQWKRNWHKKVIYRRRSKELTARAYGNVTEAQVEELARRRFEKSAKAFMQQ
TLQLGTRLRPNTLWGFYLYPDCHNYNLEQQNYTGLCPLLERRRNDELRWLWNSSSALFPS
VAIRRDHSDSASNRHFSQHRIREALRVASLTSREYQLPTFVYLRLGYRDEALTFLSAKDL
VHTIGESAALGAAGFVIWGDLNLTSSRLNCSRVRSFLRHRLGRYITNVTRAAEFCSDFLC
QGNGRCVRRDPRAHHYLHLSGRSHRIRLSDDGAFAVSGGPSQQELRLLPRRFRCHCYEGH
EGERCDSCSGAVSTGPGLELVALALLLLHLLTTTVQ
Download sequence
Identical sequences H3BX70
99883.ENSTNIP00000000583 ENSTNIP00000003967 ENSTNIP00000000583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]