SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000585 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000585
Domain Number 1 Region: 955-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.0029
Further Details:      
 
Domain Number 2 Region: 802-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 394-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000106
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 264-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 5 Region: 848-898
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 6 Region: 1064-1112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 7 Region: 331-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 8 Region: 495-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 908-957
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 10 Region: 1112-1158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1007-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 12 Region: 446-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 13 Region: 754-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000585
Domain Number - Region: 718-797,1170-1289,1444-1513,1622-1707
Classification Level Classification E-value
Superfamily ARM repeat 0.00501
Family Clathrin adaptor core protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000585   Gene: ENSTNIG00000013747   Transcript: ENSTNIT00000003476
Sequence length 1736
Comment pep:known_by_projection chromosome:TETRAODON8:13:12385871:12396151:1 gene:ENSTNIG00000013747 transcript:ENSTNIT00000003476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFAFTLFSHLQDLQDLQDLQDHCPDGFCNPSLGDLMVGRASQLSASSTCGLDGPENYCII
GYLEEEQKCFTCDSRLPYNRYSNPNSHLIENVITTFEPERKLKWWQSENGVHRVSIRLDL
ETVFQFSHLVLKFKSFRPAAMLVERSKDFGQTWKVFRYFAEDCLLHFPSVPNELANSIDD
VVCDSRYSGSEPSTDGEVVLKALDPVFEIEDPYAYNIQDLITVTNIRINFTRLFTLGDTL
LRKRRNPQDKYYYALYDMVVRGSCFCNGHASQCTPVDQGRGDTFSQPGMVHGRCVCLHNT
AGENCERCADFHHDSPWRPGGQKAADVCRRCNCHGHSESCHFDLARFEATGGVSGGMCDN
CRHGRTGPQCEHCQAKFYQDPQRARDHPQACIRCDCDLAGSKGGGLCDPLTGQCLCKDNT
EGQRCDRCKYGFFNLQPDDPNGCQECRCHVSGTVGSCDPVTGGCDCDPLAVGPLCDRCLP
GFWGLGNSLFRCSPCDCDLGGAQSTQCSPEEGQCRCLPNMVGRRCSDPAPGYFLPSLDYF
LYEAELAVPLHGGASPSTTDPPSSPLIIPRQRTGGQPVTWTGQGLVRVQDGAGLRFIVDN
LPSSMDYQLVIRYEPEAPSDWDARVEITPVSLGDGRCASEPTGRKALLLPGDSRAAVLDA
PVCLNGGGRYFVDVVFDKQPDGTPSSPLLVDSMGLIPRIESVQDFCSESDIDSFRRFRCV
GLAAELSPQESLPESCEGLISSMSARINNGAVACRCNAVGALGPSCSKLGGVCDCKPNVI
GRCCDACAPMTFGFGPDGCEACDCDPRGATSELCDQVRGQCSCRLEVTGRRCDHCRTGYW
GFPLCRPCQCNGLSEECDPHTGECWNCRQHAQGPNCDRCEEGYYGDPVSRQPCEPCLCPD
IQGSGRFFATSCHHEPQSLGLTCACREGHEGPSCDRCSPGYYGNLALPGASCELCLCNNN
IDLDDRNACDGVTGECLRCLHNTMGPQCQDCKPGYYGNALERDCKECSCDRRGTKVTQCP
LGSPCFCDPSTGQCPCRKGVVGVLCDECEDGYWNMDGASGCQPCSCDPANSLSYVCDKVT
GQCPCLTEFGGQQCDECGENHFGNPDLQCVSCDCNLDGTERPSCDPETGECMCRKGVTGI
FCDECAPGHDSEFPACRECHPCHALWAEDVTDVQKASQVLKKLIPHISDAIQPADNRLLQ
RVLDLQSKLDSLENLTALAPSAVEEVEELYEAIRNSNDTAHPNLTLPDLSPLNQQIRKVR
QEAEELLNKTRQKLDHPESGDVDELLDEINKLNNASMLDEERVRNTNQTLEDSMNTRLEA
ELNLTACCGQGDLAPLERKVTGLSVVDLNRQICGGAGLDCSECGGARCFLNGRMKCGGPN
CDGILPTSQNASETARRAANEMLTLPSRLEESKNKLNKAKQEALDSKQQAENMQDRLNAT
MDSFEMEKTKTKELIRRAKDFLLDDLVHPDDIEKMARAVLSIRLPRSPEQIQSMIEEINN
LLSNASRFQDDLKRLEEHTNITQELLRIRTKKGAQDRANDDLEAASQDTDMTRNRIAEVK
YELTGRLPPQLTRVSVTVLPFQSNNNLYHLEAKLMSQRPEDLSRRIRDVQEKTEQNRRMA
ADAREAADAALQNATAVEQEMKNVTRLFEDLKQKNSSQTIQDEAGKRLKNITDEVEKMKQ
AIEDKQRQIQELEDKILQLIKRKEEKAERVSEMVKEVESLRKEISSRADAYVICTT
Download sequence
Identical sequences H3BX72
ENSTNIP00000000585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]