SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000590 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000590
Domain Number 1 Region: 56-516
Classification Level Classification E-value
Superfamily Sema domain 3.4e-143
Family Sema domain 0.00000017
Further Details:      
 
Domain Number 2 Region: 512-553
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000122
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000590   Gene: ENSTNIG00000006164   Transcript: ENSTNIT00000003798
Sequence length 1040
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:34145401:34158759:-1 gene:ENSTNIG00000006164 transcript:ENSTNIT00000003798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALALALAAVLPLLSSGAAPFPQDLEPLSRVGRETSHLYPSFQGLLSDNDTVRLGLDFQR
MLRINHVLYIAARDHVFAVNLDASSEQIVPQQKLTWKTKDVAKCTVRGKNSDECYNYIKV
LVPRNDETLFACGTNAFNPTCRNYKMATLEQDGEEVVGQARCPFESHQSNVGLFAGGDFY
SATMTDFLASDAVIYRSLGESSPVLRTVKYDSKWLREPHFLHAIDYGNYVYFFFSEIAVE
YTALGKVVFSRVARVCKNDNGGSPRVLERYWTSFLKARLNCSVPGDSFFYFDVLQSLTNV
LQINRRPAVLGVFTTQANSITGSAVCAFYMDDVEKAFSGKFKEQRNSESVWTPVPDEQVP
KPSRPGCCAGEGSAAAYKSSTAFPDETLTFIKTFPLMDESVPSVDDRPLFTRTTSRFKLS
QVAVDTSAGPSKNHTVVFLGSDNGHVLKVLASTQGPNATFSTQLLEDLDVYNPSRCGVRG
DDRRVLGLELDRDHHALFVAFSSCVIRVPLSRCSDYSTCRKGCLSSRDPYCVWLKSGSCV
SVSPGFRGVFEQDVEAGFHQNFPDVCHDVLATTRRQNTALDSAYGLVSGVFSSAVTRRNS
VTSRTPHFSICTNHSLCYPRYDHREDHTHKRHTTSKAAALPKEAGVRRPPELDRTNHSVH
YTLLIACVLVAFVLGAFLSAFLVSCYCNRAGRRSRKLAKDPEAPIPHALSLRSLARLNGL
LDSKDQKLDVSTPQIYNSFFSSKEQLGSRRSQHHQHHHLHPPSELSGLPTPDSTPELPIK
SMKAFRNQWEKNQNCNNAKEPRSLGPAAPAVFPYPHGLSGGPLQADERKIHNVDRLLTQP
AYPDPCQKVMEVTSLDELLKHIHAGAGSKTPQLMSPSGLYAGGGAQLAFSNRIQPQIPET
ESAPYYSSSTLPRDSLTRRLDVPPDMPPHHQSTLERRQRHSLMTAMPRQHSFSQRNAVPH
QPPPLLSRMNSAGSACEVHRPLIPNGFLTRQQSFGGGEQQEVPHRGALLRRTPSLKPDVP
PKPLFIPATSPVNQQGKFNY
Download sequence
Identical sequences H3BX77
ENSTNIP00000000590 99883.ENSTNIP00000000590 ENSTNIP00000000590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]