SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000598 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000598
Domain Number 1 Region: 1-221
Classification Level Classification E-value
Superfamily GFP-like 2.72e-77
Family Domain G2 of nidogen-1 0.0000011
Further Details:      
 
Domain Number 2 Region: 578-832
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-39
Family YWTD domain 0.000000295
Further Details:      
 
Domain Number 3 Region: 386-474
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-20
Family Thyroglobulin type-1 domain 0.00066
Further Details:      
 
Domain Number 4 Region: 481-551
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.94e-20
Family Thyroglobulin type-1 domain 0.00096
Further Details:      
 
Domain Number 5 Region: 351-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000298
Family EGF-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000598
Domain Number - Region: 231-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000548
Family EGF-like domain of nidogen-1 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000598   Gene: ENSTNIG00000010343   Transcript: ENSTNIT00000003757
Sequence length 843
Comment pep:known_by_projection chromosome:TETRAODON8:3:3850836:3869697:-1 gene:ENSTNIG00000010343 transcript:ENSTNIT00000003757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVSGKVSGTVNVGSTPVELNGIDLHAYIVVGDGRAYTAISEVPELAGLALMPVAPIGELF
GWLFALELPNSQAGFKITGATFTRQAEVVFYPGNQRLSVLQTGRGLDDHNHLTVDTVLSG
SVPVLPPGAEVTMEPFKETYQYYPSIATSTSVREFTVVSAERGSESFSFQLKQNITYEDC
RHDNRAPALETLQITMERVFVMYVTEERILRYAITNKISPVGVDSSGPELINPCYAGNHD
CDTTAQCVPLGGQEFQCQCATGYRGDGRNCYESVQESRCGGVCYNNPNTPKLHRATGIEG
YIATTRQYILGKMVQLCNDPQHQCTGWLLSCMAPNNLNIWKRPSYLAKFVFSSDIDECSS
SPCHINGRCVNRLGSFDCHCQPGFYGDGFLCSQLAELPKTLCEHHRDSVQTTSPEGFPIT
GLYVPQCDHEGQYSPLQQCHGSSGYCWCVDSNGQEQAGTKTPPGTTPTNCGDPVPVPPTQ
RPESVCERWRTSLIEHYGGKPEPQQYLPQCEADGQFSPVQCYGETTYCWCVDQDGREIAG
TRSYDAVKPACLPSVAPPTVRPLPRPDVTPPPHADVTLLYAQGQKIGALPLSGTRLDETS
ARTLLTLHGSIVVGLAYDCKENHVYWTDLSARTINRAAMAPGAEPEILINTNLVSPEGLA
VDPNRRLMFWVDSNTDLIETSNLDGSGRRTLFGTELVNPRAIIVVSSTGTLYWTDWNREA
PKIESSTVEGQNRKVVVSDGIGLPNALTYDTTSGQVCWADAGTKRLECVFPDGTGRRVVH
PSLNYPFNMVYYRSHFYFTDWRRDGVIAVNKESSQITGEYLPDQRSHLYGITIATSHCLS
GEK
Download sequence
Identical sequences H3BX85
ENSTNIP00000000598 ENSTNIP00000000598 99883.ENSTNIP00000000598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]