SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000601 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000601
Domain Number 1 Region: 589-748
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-44
Family C-type lectin domain 0.0000014
Further Details:      
 
Domain Number 2 Region: 93-201
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-40
Family Link domain 0.00076
Further Details:      
 
Domain Number 3 Region: 197-317
Classification Level Classification E-value
Superfamily C-type lectin-like 6.23e-27
Family Link domain 0.0019
Further Details:      
 
Domain Number 4 Region: 748-806
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000013
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 13-93
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000185
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000601   Gene: ENSTNIG00000003947   Transcript: ENSTNIT00000001902
Sequence length 806
Comment pep:known_by_projection chromosome:TETRAODON8:5:12622437:12629443:1 gene:ENSTNIG00000003947 transcript:ENSTNIT00000001902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDPGAPTIAPLAHRIKWSHVTKERATTILVALEGQVRIAEGYLDRVHLLGYPATPTDASI
KLSELRSSDSGVYRCEVQHGIEDSHDITHVHVQGVVFHYRSGSSRYAFTYVEAQQACQSA
GASIATPEQLQAAYEAGYHQCDAGWLMDQTVRYPIISPRDKCAGDLGEQPGVRSYGLRPA
DERYDVYCYIDGLKGEVFHLGSAEGFTYDRAAASCHEQGAVLASTGELYAAWKLGLNKCR
PGWLMDRSVRYPINNPRSECGGGRPGVHTVYAHPNQTSFPSLDSRYDAYCFRDPVTVNLL
IIANETGLNITDIQEAILNITSISELLRPRGPQEAGEGNTGVLRIPLFGSGSGVLSGSGD
VSGSGFGSMESGSSLDTSGSSGDTSRSLELGQGSVEYSGEGSGSTSALHSASEDNRMFAA
SGTSSGLSSADLPQVLPPSTSSEWAPTERSAGAAEALGEAVLAQVSSGAYASHSSALAPA
GLAAPPTTAAPGPVGAPGIAMETHHLQVCDGKWIGRSSRLRSQVAPTPANPTPAALLPAP
NRPDSPADLQRTQRDRAPRTAPPPPTPPAETVESPGPFLAEVDVCHSNPCLNGATCVESA
DSYKCLCLPSYGGRRCQIGTRSASEGWTKFQGNCYLHFSDRETWLEAEQRCRDLNAHLAS
IITPEEQEFVNANAQNYQWIGLNDRTVQNDFRWTDGTPLQYENWRPNQPDNYFSSGEDCV
VMIWHERGQWNDVPCNYHLPFTCKKGPASCGAPPEVENAYTFGNRREEYPVHSIIRYQCK
PGFRQRHAPVVRCRVDGQWEQPQVEC
Download sequence
Identical sequences H3BX88
ENSTNIP00000000601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]