SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000631 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000631
Domain Number 1 Region: 355-542
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 8.11e-81
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000386
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily A heparin-binding domain 5.23e-44
Family A heparin-binding domain 0.0000024
Further Details:      
 
Domain Number 3 Region: 125-189
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 3.53e-30
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000175
Further Details:      
 
Domain Number 4 Region: 285-342
Classification Level Classification E-value
Superfamily BPTI-like 9.22e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000631   Gene: ENSTNIG00000013912   Transcript: ENSTNIT00000000225
Sequence length 738
Comment pep:known_by_projection chromosome:TETRAODON8:2:11685762:11693208:1 gene:ENSTNIG00000013912 transcript:ENSTNIT00000000225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEMRAFVLLLAATLTLSSEVPADDTVGLLTEPQVAMFCGKLNMHINVQNGKWESDPSGT
KSCIGTKEGILQYCQEVYPELQITNVVEANQPISIQNWCKKGRKQCRSHTHIVVPYRCLV
GEFVSDALLVPDKCKFLHQERMNQCESHLHWHTVAKESCGERSMNLHDYGMLLPCGIDRF
RGVEFVCCPAETERETDTSEIEGGESDVWWGGAEPEYSDSSPPTPRRMRVAEDAFERDET
GDDEDEEDDDDDDVDVTDEQESDERGASVAMTTTTTTTTESVEEVVRAVCWAPAESGPCH
AMLERWYFSPEKRRCVPFLFGGCGGNRNNFESEEYCLAVCSSSLPTVAPSPPDAVDQYLE
APGDDNEHADFKKAKESLEAKHRDRMSQVMREWEEAEHQAKNLPRADKKAVIQHFQEKVE
ALEQEAAGERQQLVETHMARVEALLNSRRRLALENYLGALQASPPRARQVLSLLKKYVRA
EQKDRQHTLKHYEHVRTVDPKKAAQIRPQVLTHLRVIDERMNQSLALLYKVPSVASEIQN
QLHTCRGEQQKLNIQNTVCPQLDGLVSYGNDALMPDQAYSSAPMDTGLDGLGFVHPESFN
QANTENHVEPVDARPVPDRGLPTRPVSALKPEEMPQVRMETDERQSAGYEVYHEKLVFFA
EDVGSNKGAIIGLMVGGVVIATVIVITLVMLRKKQYTSIHHGVIEVDAAVTPEERHLARM
QQNGYENPTYKFFEQMQN
Download sequence
Identical sequences H3BXB8
ENSTNIP00000000631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]