SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000633 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000633
Domain Number 1 Region: 14-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-17
Family Leech intramolecular trans-sialidase, N-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000633   Gene: ENSTNIG00000018085   Transcript: ENSTNIT00000003380
Sequence length 1248
Comment pep:known_by_projection chromosome:TETRAODON8:1:20983712:21015129:-1 gene:ENSTNIG00000018085 transcript:ENSTNIT00000003380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVDVLYQLGLMPQSGAGNLYVKASSSSAPHTTVPSSLILSVTGYGVILDSNSLYEASAKS
LIPPEVGDEFSFVVSFSSRRANNAFLFSIKDSRDRLVFGIQLLPRRVVVHTAKNTPVYFT
YNWQDGGPRPFAVGVRGHSVTFYADCGAVQQRETVARAQVLRDPGGLFTLGRINSKSAPF
IGQVCQLDIYPSAQAAVHYCNYLKTQCRRADTYRLPHPGLDMEANDPPYDHLINSLVGVA
ATHRSSLKSPAVFKLDSNPLVTQHPAPSSSAQPDLEDQSSLATLYPPSTTSLLLPGSPLL
TINPSGVLDPTQSATMKTTTKIVWTKQKSPDEEADPSEKSAEEESSSGSLQATEVALDLI
TSVRQSQENEGNKPSSVVPHETLQLDNNRGNGTTLYRENQVDQQPEQDNSFDDVDMRGYD
YGYEDFLYEYEDGFHGPKGEPGPMGPPGPPGLPGPSGKRGSRGPTGPHGNPGQPGLSGPK
GSKGDPGLSPGQAPPGQKGDRGPPGPPGPKGFPALPGPKGRVGPPGPPGEQGIPGPPGEM
GEAGFPGRQGSAGPQGNPGPKGVRGFIGPPGFSGPPGIEGEKGIPGPVGKSGPKGQHGVL
GVVGERGPPGPDGKEGPVGGTGIGGFPGLRGDIGPEGPRGLPGIMGPQGPAGRAGLPGLR
GDKGEIGNRGEPGEMGYQGDKGIVGMPGPAGPRGHPGPPGKIGDIGAQGPPGPPGPEGFP
GDIGLPGPNGIPGPKGLVGSRGPQGPPGPKGTQGDEGPLGPPGNTGPTGRPGRKGYVGEP
GPDGLVGEKGDVGNVGKTGPQGPHGLDGVAGVLGAPGEKGERGPVGPTGPLGEKGPRGYP
GMPGSPGDIGLQGAPGPQGPRGSLGIPGPKGRMGPQGPDGPAGESGPEGTKGEKGVLGQK
GELGSIGKPGGLGSTGEKGPPGEPGPKGPPGEAGMEGHQGIEGEPGEEGQPGVIGEPGLK
GDIGPPGHEGEQGQEGIRGPPGPPGEDGPQGKDGPKGDPGEQGPPGEPGDKGIEGDPGPL
GPPGEPGKQGFRGPEGKPGPPGNRGRHGKKGERGLSGALGEIGERGDAGQPGEPGPKGAR
GTRGAPGQPGVMGMEGQPGLPGYTGHPGQPGPIGPPGAKGEKGYPGEDNKTPGPPGPLGE
PGPPGERGDRGEPGDEGYQGHSGLTGSRGAAGPQGPTGGPPGLPGEPGPKGETGTPGSAG
KKGGRGQVGAPGVEGPAGLPGLKGMKGYPGLEGPPGLTGLPGLPGKPG
Download sequence
Identical sequences H3BXC0
ENSTNIP00000000633 99883.ENSTNIP00000000633 ENSTNIP00000021250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]