SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000664 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000664
Domain Number 1 Region: 394-963,1015-1183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.34e-201
Family Motor proteins 0.0000000306
Further Details:      
 
Domain Number 2 Region: 72-311
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.72e-46
Family Ankyrin repeat 0.0000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000664   Gene: ENSTNIG00000013925   Transcript: ENSTNIT00000002903
Sequence length 1845
Comment pep:known_by_projection chromosome:TETRAODON8:2:11874466:11919522:-1 gene:ENSTNIG00000013925 transcript:ENSTNIT00000002903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCFQLCNVFRQNMEIDQCLLESLPIGQRQRLVRMRCDQIKAYYEREKSLQRHTGAADHRR
KPRVQFGLADVIQDAIVRHDDKEVLRLLKEGADPNTLIPSGGSLLHLCARHDNVFAAEVL
IERGVNVNLQDEDLWTALHVACVCDHADVVLLLLLAGVNMLLQDVNGNIPVDYASEGTES
SWILRKHLEENGVDVSSIHTMKMQRRSTMMSDVRQLVATGEGLSQSNEDGVTLLHIACAG
GYREVVSMLLEKGADPDAADDNFWTPLHLGSKYGQTSVISQLLRHGANPTLLNCNHHKPS
DIGASEHITEMLLNAEESWLQRQADPSAPLPSADQCYDGGSHDVNTPVKNMNLGLPLSKR
DSLLEKCTLFREAGVALIRHPSQDNGLDGPFSSGTSKVEQVKLMPPAPNDDLASLSELTD
SSLLYEMQKRFSNDQIYTYIGHILLLVNPNKELPIYSTLVSQLYLSSTGRLCSSLPPHIF
SSAERAYHMMLQERRPQCFVLSGESGSGKTEAFKHIVRHLTGRSSPKGFALEPKMKHVNC
ILEAFGHAKTPRNNNSSRFIKLMTIQYCEKRKMPLGARLCTYMLEKSRLVHFHPHQHNFN
IFYLMAEGLSPEENSTFYLSNVLAHRYASGEPPQVAKASAQSKEQLTEVKQALRALGFNK
QEVESVFMLLAAVLHLGDVHFTPLTDADTAFPSDPQLLERVSGMLQVCPNDLSSALTSDV
QIFKGDAITRRHTVEMSEQNRDQLAKAIYGRLFSYLVNTANGYLQGQDDLLGDPAFEIGI
LDIFGFEEFLKNGFEQLCVNIVNERLRRYVSEMLFQQEQAECVLEGVPMEPPCSPCNQPA
VLDFFLQQRPQGLLSLLDEESQSPRPVEQMLYKRLSAQLESSSGHGLSLTTKDGNGNPPP
KDQGPAFTVHHYAKQISYDLTGSLSRNKDALPQNLVFTMKSSESVLLRQLFRSKLTQTGS
LVPTAQGRAGSRGPKAALLLYKMPSASLVTAGAIPSKPQRSLDLTRILKKKCPSSFLQQL
ERCGPITVTIQLKNSLSEVISKLQACTPHFVECVRPNTSGQPDSFDSFHVSAQLQYIRVL
EMVRTIRYGYPVRLSFPCFLSRYKDLTIPMLGDKKKVSPEERCRLVLQQTKLQGWQMGSS
KVFLRYWQADQLNDRCYQLHKKIITCQKVVRGWLARRRLHHRQSSRQKMVHSVQRFLQGA
EDMGLRTYDQLVIQNAADIARESDRLRCHAPLAKAHPLVRGLSQSERKRINPPGVLRVRL
VYVFTWSTFRGVEKTGKVFEGPVNISHSNEEVLAVGSLSSPRKQPPPKPKRDPNTRLSAS
YETVSAGLTMAAKESPTPALSKPRPYSDDYTTMREVPPPKTKQRPNTKLSGSYEEINAVA
PHIHQLRPADVKLALLSRSAGFGGFGGLMQKAASIDAPQGVGLSLYKGQDEEDVYIEMMG
SQQRARSLQEPPDSPIQADSEAVYEEMKYFPTEDGVTSAAAVTKATNTPSQSTLNSFKTL
HGKDGSCDIPAPFPNLLPHRPPLLVCPPSPVTCSPASDESPLTPLEVKKLPVFETNLNYA
TAPDSPLSPQCSRQRADSSPSLTVFIPEKKSTPPLTPPPPPPPAQPPPYRAPSHFPFPPE
ASFLTLTRAASVAGSSDTPKALSSQRASGEPLGKPPPYSPVKMTRPEPRRAHSCSSSPLL
FNPANGRALTSPLEELNTLFSSGRSLLRKSTSGRKMRDGERFNSNINLPGKDECGSAPTS
PSLQLQDKNANNRSTQSSSPVPIENGNQITNGLMEDESHSKPNTSTSTSLHRHMDSHHIQ
VINRFRLLSGDEAAASGDLQRWRREQCEGRGDWKGCPPPHTPLPP
Download sequence
Identical sequences H3BXF1
ENSTNIP00000000664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]