SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000675 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000675
Domain Number 1 Region: 1-446
Classification Level Classification E-value
Superfamily Sema domain 3.79e-154
Family Sema domain 0.00000000476
Further Details:      
 
Domain Number 2 Region: 504-602
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000185
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 449-488
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000262
Family Plexin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000675   Gene: ENSTNIG00000014428   Transcript: ENSTNIT00000003303
Sequence length 796
Comment pep:known_by_projection chromosome:TETRAODON8:2:1152204:1162110:1 gene:ENSTNIG00000014428 transcript:ENSTNIT00000003303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYSTLLLEEGSGLLYVGGRGVLYALNTTNISTAAGLRIDWDASPEQKKLCLNKGRDNQTE
CYNHIRFLQRYNESHLYTCGTNAFRPLCAYIDAERFSLVSGFEEGRDRCPYDPAKGYTGL
LVDGEMFTATQYEFRSSPDVRRNFPFPTLRTEEAPTQWLLEADFVGSVLLKESINSSIGD
DDKIYFFFTERSQEQVVYPSQTKVSRIARVCKNDWGGQRTLQKKWTSFLKARMMCSVPEY
ELHLNILRSVFVLQGRDARNSIFYGIFGLEWKNIKASAICQYAFSDVQKVFDGPYMEVQD
SKWREYTGRVPEPRPGSCITDVHRSQNINTSRDLPDNVLTFARRHPLMARQVHPIGLRPL
MFKRSVNYVKIAVHQEPALDGILYTVLFLGTDDGWLHRAVDIRGEMHIMEELQLFEKAQP
VQALVISSALRSIYVSSSSGLVQVPMAACQRYASCYDCVFARDPFCGWDGKACVELASRA
QRLLLKQLLRDFTAGCCSPIRQVPVQTITHRKRSVMAGDDVLLQCELRSNLASPRWTLNG
RELMGYGLNSGYRIGTDGLLIIGARAQQSGTYRCFAVENSVSVLVFLYSVRVHTDPFFPV
EPTASKFQTYRHMEAVYISLVAVLGGLCLVLTVVLLYMSFCTRLAARGRKSSQQGLQVLG
ASERKRSSHFELKTISSHCNGRQDRRSISVPTFGAMGDGFLQMVPGECQLSPAKTPPPAP
PLPMPPPLPNMDYANGLSATLPSVLRKMNGNSYVLLRQADSEGMSPLYHSFTEELNRILE
KRKHTQLSLQPDESSI
Download sequence
Identical sequences H3BXG2
ENSTNIP00000000675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]