SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000705 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000705
Domain Number 1 Region: 262-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-35
Family Laminin G-like module 0.00000612
Further Details:      
 
Domain Number 2 Region: 41-93
Classification Level Classification E-value
Superfamily GLA-domain 6.9e-20
Family GLA-domain 0.00055
Further Details:      
 
Domain Number 3 Region: 463-663
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.34e-20
Family Laminin G-like module 0.00017
Further Details:      
 
Domain Number 4 Region: 116-240
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000705
Domain Number - Region: 236-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000157
Family EGF-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000705   Gene: ENSTNIG00000009448   Transcript: ENSTNIT00000003330
Sequence length 671
Comment pep:known_by_projection chromosome:TETRAODON8:5:8290773:8295751:1 gene:ENSTNIG00000009448 transcript:ENSTNIT00000003330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVRVGRIPLITTNLIFIITIITTTVLSPSTASQFLRRHRRANSLFEESKPGNLERECIE
ELCNKEEAREIFENQPETEYFYPKYVVCLGSHRVGIRNQQSDIPTDLRTCVTEISNQCSP
YPCYKEGSMRCVDGLASFQCVCKPGWKGQRCEDDIDECSDPEFPAGCNQKCINVPGSFQC
QCESGYFSDDRITCVDIDECQLYPSICKEPARCLNLPGVYECRCPRGFHYNFTSRTCSDV
DECQMSVCDGLCRNTVGSYQCHCDGRLGLRLAEDGRHCQRIPVCVDLFDYKHPEMLYLGE
QFSSLPVMFLRYRLPENTKFAAEFDFRTFDPEGVVLYAESSQDSWFMLGLRDGRIEVQFN
NQHTFKLTSGGKAINDGQWRVISVDELESSISVKISKEAVMSINSPESLFVPVNGVVETK
VYIAGLPERADIIKQINPRLDGCIRAWNLMNQGASRVKEVIQERKSKQCFVSVEKGSFFS
GRGLASFDIDYSYASAGDSGSWSADVKMSIHPSSSTGVIFALVLNSSVPLSVAVITQGEE
EANLQVFLDGVSVATLDSLMLCYPERLTVHLKVTPAAVQISGNSSTVTYAEPAFLQEALE
RLNATMHNPVTTYIGGIPVLRVDRQPGDAFYHGCMEISVNGRQLDFDEALTKHNSIKSHS
CPPASASESQP
Download sequence
Identical sequences H3BXJ2
ENSTNIP00000000705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]