SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000724 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000724
Domain Number 1 Region: 1127-1350
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.27e-84
Family Fibrinogen C-terminal domain-like 0.00000145
Further Details:      
 
Domain Number 2 Region: 595-762
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-22
Family Fibronectin type III 0.0000505
Further Details:      
 
Domain Number 3 Region: 956-1121
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-21
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 776-953
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-20
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 414-503
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-17
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 328-414
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000413
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 7 Region: 503-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000052
Family Fibronectin type III 0.0000177
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000724
Domain Number - Region: 241-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 210-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 272-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000724   Gene: ENSTNIG00000015254   Transcript: ENSTNIT00000002695
Sequence length 1360
Comment pep:known_by_projection chromosome:TETRAODON8:15:5938176:5971782:1 gene:ENSTNIG00000015254 transcript:ENSTNIT00000002695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFISIAVVLQVSNLLFGSHIIDFGNRLISPSADNKLVRTTRVRRQTLAGGQAPPLSSENQ
TTREQPLVFNHVYNINVPLESLCSVDLDSAASAGPTDDPSGPTEYTEQTLDADSQMTFTH
RINIPKACGCPATATIQQLVTRVEMLEKKVSLLKAQCGSGCCSEGSAMGRVDFVPGCSGH
GSFSFDLCGCICEEGWAGKNCSEPRCPDDCSGQGACVEGECVCDRDFGGENCSEPRCPSD
CSGRGLCIDGECVCEESFTGEDCMVGRCLNDCSDQGTCVNSTCQCRPGYVGEDCSLVYCA
NNCRKGLCKDGFCVCQDGFAGDDCNSVAPVMSLKIRGVTDRSVDLEWDGSVVLTDFLVTY
TPSSAGGVPLEIRIPGNTTACTISDLEAGVEYNINVFAVINNSISVPASITVSTYLSNPD
GLVFKSITETSVEVQWKPFYYSFDGWEISFIPKDNDGGMTAQLPSTITSFVQTGLRPGEE
YTVNLVALRDQGRSQPVTATVTTLIDGPTQLMVRDVSDTVAFVEWTPPKAKLDQIVLRYG
LVGEGPRTTFRLQPTLSQYSLQVLRPGSRYEVSVTGVRTGNESGSISTEFTTEIDAPKNL
WLVSKTSTTLELEWDNSEAEVDGYQVVYSTLAGEQYDKVIVPRNEGATTKTALTDLLPGT
EYGIGISAMKGSNQSTPATMNARTGLDVPMDLTVTASTDNTITLVWGVVQGPIDHYRVTC
TSSSGVTTELTVPKDVTTTTLAGLDPGTEYTITVAARRGRQQSNVATIDAFTGIRPVTHL
FLSEVTSDSVLVAWSAPAPPADLFILSYSSSDGTDTSKVTLDGSKTASLIQGLLPSTPYT
ISLITIQADITSEPITASLTTGMKMHGPHPRKIMVSDVTEDSVTLSWIRPLAPFEYYKLS
YQSARGRVDSMVIDSDVTNYTLSSLFPATEYEISLSAVKESQESSVVSTSVFTAMDMPSE
LTALNITPRGALLRWNPPLSVVDNYVLTLTHNQVTADTFLVEGTKQEHQLSSLSPSTSYS
VALYATKGPLTSGTVITNLQTPMDAPLNLTASEVNHRSALISWQPPMAEIDNYMLTYKSV
DGGRKELILDAEDTWIRLEGLAEITEYTVKLQAARGLDTSAIVSTTFITGSRLFAMPQNC
AQHLLNGETLSGVYTIYINRDPSQGVQVYCDMTTDDGGWIVFQRRQNGLTDFSRKWSDYR
VGFGNLEDEFWLGLDNIQRVAAQGRYELRIDMKDGQESVYANYDKFSIGDARDLYKLRIG
EYNGTAGDSLSYHQGRPFSTKDRDNDIAVTNCALSYKGAWWYKNCHRANLNGKYGESRHS
QGINWYHWKGHEFSIPFVEMKMRPFNYRSISSKRRRSAPV
Download sequence
Identical sequences H3BXL1
ENSTNIP00000018312 99883.ENSTNIP00000000724 ENSTNIP00000000724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]