SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000726 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000726
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-39
Family C-type lectin domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000726   Gene: ENSTNIG00000001023   Transcript: ENSTNIT00000003709
Sequence length 140
Comment pep:novel chromosome:TETRAODON8:Un_random:75809141:75810081:-1 gene:ENSTNIG00000001023 transcript:ENSTNIT00000003709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGWEEFEGQCYYFSDIRLKWEEARERCQLQGADLVQVSSRKEQEFLTDRVKPMMRDNDDR
FWIGLTDSVTEDTWLWVDGSSLDQGLKFWAIDEPNNYLGEDPENGEDCVRMGNTGGNINS
WNDRACSHPGRSICEKAICR
Download sequence
Identical sequences H3BXL3
99883.ENSTNIP00000000726 ENSTNIP00000000726 ENSTNIP00000000726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]