SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000736 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000736
Domain Number 1 Region: 880-1168
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000129
Further Details:      
 
Domain Number 2 Region: 109-216
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-27
Family Second domain of FERM 0.00054
Further Details:      
 
Domain Number 3 Region: 217-360
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-22
Family Third domain of FERM 0.01
Further Details:      
 
Domain Number 4 Region: 22-108
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.53e-18
Family First domain of FERM 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000736   Gene: ENSTNIG00000016380   Transcript: ENSTNIT00000002579
Sequence length 1172
Comment pep:known_by_projection chromosome:TETRAODON8:14:5140048:5154783:1 gene:ENSTNIG00000016380 transcript:ENSTNIT00000002579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDMPFRLKLRRTRRYNVLSKNYFVTRIRLLDGNVIECTLSVESTGQECLEAVAQRLELRE
THYFGLWFNGKTQAPAHRWVELEKPLKKQLDKFGNEPLLFFGVMFYVPNVSQLEQEATRY
QYYLQVKKEVLDGRLHCAVEQGIRLAGLAVQADFGDFTQFMSQDFLREYVLFPVNWPTGD
EVLEEWTKKVAEEHKSHCRMQAAEAELLYIKEVEKLDGFGQETFPAKDNYTNDIFIGVSF
IGVFVKHRNGRSIMLHKWKDIGTVAHNKSAITVEITSRDDTIIFHMEDMEMAKYIARLFT
TRHKFYKQNKICAEPTHSPAPIRRRPTWTHRISLPRPQSCNFQSMHSQYGEHYQDTQSSQ
DSIFHDDPYYKSETSLDRCPVDFPFRNGTVPNGSMYSSPSLSSLNHSQTFVPPSPMSSNL
SIPGSELMRPDYIPSHRHSAIIAPSYRPTPEYDAVMRQKRRMLPAHHDLHSQSLRSLNIS
NSCAYRQPEALVYSQPEMRDRGPYHGHGPSPGQYTPQVQISYSKPVSHGPHQHTVSTPEL
ANNKQQGANLGNYAATANMLRNHMSRPPPPYPSSHFRPATSTPDLASHRHRCISGSSPEL
VTRMVQLSVKTFQPDSSAVVHQSLQEVSEPLTVAAKHRSTLGKRHSMEVISSMRGGGGGV
EGLMMKSINGPLHRRNTLREHVMRTQAQSIPQPQTSPPGPSGPYQHQKTLSNATMLIHSS
ESEEEDEEEEERPELDVQIPGLNEDISISAQLQAALAKLPNKPPPDYPGPPKPQNNAQIR
THIHSHKHAHHLNHGHVLGPSISEPDLTSVKERVRKEPVKERPVSEMFSLEDSIVEREIA
QRVRYSLKRPLMMAALNGLYVARMPVPESPAEDGTKATDERCKTLELKLEEERVFTEYER
VPKKSVDCVLTTATLPENVERNRFRDVVPYEENRVELVPNKENNTGYINASHIKVMIRGE
EWHYIATQGPLANTCADFWQMVWEQGVNVIAMVTAEEEGGRSKSHRYWPKLGSKHNSATH
GKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPEQGCPEYVQGFLSYLEE
IQSVRRHTNSMLDTSKSLNPPVVVHCSAGVGRTGVVILTELMISCLEHNEPVEVPTMLSE
LRQQRMLMVQTISQYKFVYQVLIQFLKNSRLI
Download sequence
Identical sequences H3BXM3
ENSTNIP00000000736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]