SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000750 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000750
Domain Number 1 Region: 530-576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000575
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 
Domain Number 2 Region: 109-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 46-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 4 Region: 486-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000887
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000750   Gene: ENSTNIG00000007870   Transcript: ENSTNIT00000002164
Sequence length 577
Comment pep:known_by_projection chromosome:TETRAODON8:15:2858912:2862063:-1 gene:ENSTNIG00000007870 transcript:ENSTNIT00000002164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFSTVCMVVNISACHSGVVVATAGDEDLASVRQARSAGGQVTAQPVDCVLSEWSAWSRCD
TCQKKRYRYAKLEQPSQFGGQPCNFHGREEEACTVSSRYTCDNIPVCEGFLCATTGRCIP
RTLQCSGEDDCGDMSDEVGCRKVSKPCRSEAEEYWGIENLAKGINVLDSNLAGVVLDNRY
YAGSCLPHYIQDVRFRKPYNLEQYTLQTKGSYDFILHSYDSYSSYMDFTLKERMTQTVVS
FGFAIPGVFEFGFNYNSAKYSKSVKKLRRVSGKSYSFVRAKAQLELAQYMLKSNDLMLHP
EFLHRLRALPLSYVYGEYRQIFQDYGTHYITEAALGGEFEYTIILNKERLEQSDYTLEDY
KKCAQAGLKVGANIYGVYVSAGVHGGSCNGLLNEMGENTARGSMVEDFVSVVRGGTSESI
TALLSKKLPTPELMRLWGEGVQFNPDFIRRTTQPLYELVTSRDFSQASTLKRNLKRALSE
YLAEASACRCAPCLNNGVAVLRGTRCDCICPVGYTGDGCEITTRRGDVAIDGSWSCWGPW
SSCSGGTVTRSRQCNNPAPSFGGMACRGLQQESTSCS
Download sequence
Identical sequences H3BXN7
ENSTNIP00000000750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]