SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000763 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000763
Domain Number 1 Region: 55-142
Classification Level Classification E-value
Superfamily Moesin tail domain 2.09e-34
Family Moesin tail domain 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000763   Gene: ENSTNIG00000000921   Transcript: ENSTNIT00000003814
Sequence length 142
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92606785:92608769:-1 gene:ENSTNIG00000000921 transcript:ENSTNIT00000003814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DESQAIQANQQATTMQEDLEKTKEELKNKVMVAHIQEPLNAENEHDENDESSAEASAEFG
AAVTYNDRSEEERMTEAEKNERLQKHLLVLSSELANARDESKKTANDILHAENVRAGRDK
YKTLRQIRSGNTKQRIDEFECM
Download sequence
Identical sequences H3BXQ0
ENSTNIP00000000763 ENSTNIP00000000763 99883.ENSTNIP00000000763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]