SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000774 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000774
Domain Number 1 Region: 101-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000681
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 2 Region: 61-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000441
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000774   Gene: ENSTNIG00000010500   Transcript: ENSTNIT00000003373
Sequence length 734
Comment pep:known_by_projection chromosome:TETRAODON8:1:17245754:17253368:-1 gene:ENSTNIG00000010500 transcript:ENSTNIT00000003373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLPFSVALVNALPEQFRGKSSCHQLATCEAQNESKAGCYCKHGYTGDGTTFCDDPDDN
ECQNVTNICGERGNCTNTEGSYYCTCLPGYESTGNSSFQPNDGTECIDIDECQWAKERCG
LNSHCHNTYGSFYCTCQRDYIPTSGTRHFHSGKVVKCKENPQKYCHHSIECITETINQTL
ENMRNFTEPQDLLKEIVKQTSGELSAVEVITYVEALSRSTSILVSTEKDASMEPSSINFT
LTKLVNAANNLVEKDELAAWNRMKEEHRERTITKLLHTVEESALTLAKNYKIPTELQIKA
PDMEMKLYTIDAGQTKARVSASMAGDHINLSPKLQAAKDRNGSVSVVFVHYDSVGAILEP
SSSQGVAGTGEITVNSRVVAAAVRPADIYQLDHVTFTLRHNQEISDIEGDAIKCAFWEYE
PERLQGRWSTRGCRTLHVSSNATTCSCDHLTHFAILMSSGQANLGAHALVLTRITQLGMI
ISLICLSMCIFTFWFFREIQSTRTTIHKNLCCSLFMAEFIFLVGINMTAHKLFCSVIAGL
LHYFFLAVFAWMCIEGIHLYLIVVGVIYNKGFLHRNFYIFGYGSPAVVVTISATLGSKYY
GTDKVCWLSTENHFVWSFIGPACLITLVNLLSFGVIIFKVYRHTAVKKPETSHYENIRSC
ARGAIALFFVLGVTWTFGVLHILHETTLTAYLFTISNTFQGMFLFIFLCVLSRKIQEEYY
RLFKNVPCCFECLR
Download sequence
Identical sequences H3BXR1
ENSTNIP00000000774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]