SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000838 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000838
Domain Number 1 Region: 37-215
Classification Level Classification E-value
Superfamily vWA-like 5.4e-36
Family Integrin A (or I) domain 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000838   Gene: ENSTNIG00000016713   Transcript: ENSTNIT00000000327
Sequence length 487
Comment pep:known_by_projection chromosome:TETRAODON8:12:9737941:9757782:1 gene:ENSTNIG00000016713 transcript:ENSTNIT00000000327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGAQKELRARGRWSSAALAALLLCVFASSSWAEEASCHGAYDLYFVLDKSGSVAGDWGEI
YSFVKNLTDRFVSPRMRVSFIVFSAQAKVLLPLTGDSYKIKEGLRKLYDVKPAGETFMHV
GIKEASVQIRAQPSPTSSIILALTDGKLEVYVHDLTVKEANEARKYGARVYCVGIKDFDE
QQLANIADTKDQVFPVKDGFHALKGIVNSILKRSCTEILSVEPSSVCVNETFDIVLRGNG
FTLGRTNEAVVCSFIMGQRTFNHKPSTVRDDYMLCPAPELYEEGQTMDVLISLNHGKTFI
SGSHTITASACSSGWAVAIVFLVLLILVALALMWWFWPLCCKVACRWPPPPPPLNDRRST
ERLPSDQSWRRLSFLYAAGRGRIILKSCSVRWGEKGSTEEGARLEKAKNAVVTVPEEEPE
LPQSRRSAATAPRYHRNQNKWYTPIKGRLDAVWALLRRQYDRVSLMRPTSEDKDPSRVMN
FSAGCFR
Download sequence
Identical sequences H3BXX3
99883.ENSTNIP00000000838 ENSTNIP00000000838 ENSTNIP00000002600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]