SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000847 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000847
Domain Number 1 Region: 254-621
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-88
Family Ankyrin repeat 0.00000682
Further Details:      
 
Domain Number 2 Region: 49-300
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.59e-58
Family Ankyrin repeat 0.0000686
Further Details:      
 
Domain Number 3 Region: 603-821
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.95e-46
Family Ankyrin repeat 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000847   Gene: ENSTNIG00000017774   Transcript: ENSTNIT00000000889
Sequence length 914
Comment pep:novel chromosome:TETRAODON8:21_random:1499597:1507469:1 gene:ENSTNIG00000017774 transcript:ENSTNIT00000000889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SERVSRVCIVVLEEVEEDEPSPPPPPPQCRSPPERRSRPVCRKAAGHQDKPSLLRAIFNV
DPDEVRSLILKKEDVNVQDNEKRTPLHAAAYLGDAEIIELVVLSGARVNAKDNKWLTPLH
RAVASCSEDAVAALLKHSADVNARDKNWQTPLHVAASNKAVRCAEALVPLLSNVNVSDRA
GRTALHHAAFSGHVEVNEVNAYGNTPLHLACYNGQDVVVGELIQAGAKVNQENERGFSPL
HFASSSRQGALCQELLLTHGAHINIQSKDRKTPLHMAAAHGRFSCSQALIQNGADIDCED
KDRNTALHVAARQGHELIITALVKHGANTARRGVYGMFPFHLAALSGFSDCCRKLLSSGF
DIDTPDDFGRTCLHAAAAGGNLECLNLLLKVGADLNRKDHFGRTPLHYASANCNYQCVFA
LGGSGASVNVLDQRGCGPLHYAAAADTEGKGHQDCVALLLHHGASPMTRDYTHKKTAMHA
AAMNGHQECLRLLLSHSQHLDVDAQDINGQTPLMLAVLNGHTECVYSLLSQGASVENQDR
WGRTALHRGVVTGQEDCVEALLQRGANVCVRDAQGRSPLHLASACGRVAVLGALLQAGSS
SHTHLTDNQGYTPLHWACYNGAGYDSCVEVLLDQEVFKQVKGNAFSPLHCAVINDNEGVA
EMLIESMGTNIINTSDSKGRTPLHAAAFSDHVECVSLLLSHGAEANAVDARLSRTPLMMA
ALNGQTNTVEVLVNSAKVDLTLQDAHRNTALHLACSKGHETCALLILEKIRDRNLINCPN
AALQTPLHVAARGGLTVVVQELLGKEASVLAVDENGYTPALSCTPNRDVADCLALILNSM
MPTSPMVTIAALPAVSVAQAVIKHHPTNKRISKGVGLEALPPLRPNHASCCRTERPLSSV
SAEEELNDSDSETY
Download sequence
Identical sequences H3BXY2
ENSTNIP00000000847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]