SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000871 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000871
Domain Number 1 Region: 1755-1853,1944-1970,2122-2172,2295-2361,2503-2523
Classification Level Classification E-value
Superfamily Sialidases 0.00000216
Family Sialidases (neuraminidases) 0.049
Further Details:      
 
Domain Number 2 Region: 342-400,499-560
Classification Level Classification E-value
Superfamily Sialidases 0.0000108
Family Sialidases (neuraminidases) 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000871
Domain Number - Region: 697-729,869-930
Classification Level Classification E-value
Superfamily Sialidases 0.000115
Family Sialidases (neuraminidases) 0.058
Further Details:      
 
Domain Number - Region: 1322-1346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00081
Family Integrin beta EGF-like domains 0.062
Further Details:      
 
Domain Number - Region: 227-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 585-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 2037-2062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00242
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 1075-1129,1235-1275,1585-1612
Classification Level Classification E-value
Superfamily Sialidases 0.00255
Family Sialidases (neuraminidases) 0.058
Further Details:      
 
Domain Number - Region: 132-205,340-374
Classification Level Classification E-value
Superfamily Sialidases 0.0144
Family Sialidases (neuraminidases) 0.028
Further Details:      
 
Domain Number - Region: 2508-2639
Classification Level Classification E-value
Superfamily Sialidases 0.0559
Family Sialidases (neuraminidases) 0.024
Further Details:      
 
Domain Number - Region: 2388-2416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.08
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1419-1608
Classification Level Classification E-value
Superfamily Sialidases 0.085
Family Sialidases (neuraminidases) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000871   Gene: ENSTNIG00000016036   Transcript: ENSTNIT00000001450
Sequence length 2987
Comment pep:known_by_projection chromosome:TETRAODON8:13:10713305:10732867:-1 gene:ENSTNIG00000016036 transcript:ENSTNIT00000001450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFEKEGRRRVCTPYIDTTSYGNLRFYFTMGGGDCDPGETHENDVIVYGKSEGRRERVVLD
TLPYSSYRTPAVVSLALPTDLQTPVTKFCLEQRSHGGPDRHVWAMDFMQLLPVLPGTHTH
LAQFSINLGCGSYQPANSVSLEFSTNQGRSWSLLHTECLPELCAGPHLPHSTIYSSDNYS
GWTRISIPLPNAALTDATRFRWKQSGTVAGSMWAIDNVYIGPACLRFCSGRGHCSRTGCK
CDPGFSGPACELASQTFPAFLSEGFSSPRLSSYHSFSSLRGAEVSFGCGVLASGKALVFN
RDSRRHLVTTPLDSSQARYLQFTLRLGSRSTLSSCPAPDQPGEGVLLHYSSDNGITWTLL
QHYAYQGFHEPRIVSVELPSGARKFGVQFRWWQPYHSGRGQDVWALDEISMTSVLFNTIS
LDFSNVLDVTQSLGFYLGHVQPYCQHDWTLSFSGEPSPGSIIRYVETQSMQIGASYSLQF
SLVMGCGREPSPHIDTQVRLEFSTNHGLTWHLVKEACLPGMPSCSEFTAPSVYHPSEFKN
WRRITLSLPQKTWSSATRFRWIQNYYGEQDEWALDDIYIGQQCPNMCHGHGWCDHGHCRC
DDGFSGTDCQPSSPLSSSVLSDFESQDALLATWQEVIGGEVVTPDMGCGVVSSGSSLYFS
KAGLRQLMSWDLDTEWAEFVQFYLRVGGDWAECNQADSREEGVLLQYSNDGGISWGLIAE
MYFTDFTKPRFVHYELPLASKTPSTRFRWWQPLHSGEGYDQWAIDDVIILSEREKHIIPM
ANPTLPQNFYEKPAFDYPLNQMSVWLMLGNEGMERESNDIPTPSAMVFGRSDGDRVAVTR
DLALRHGYTLQFKLNIGCESEFSAAAPVLLQYSHDAGRTWALVREGCYPGTPGSGVCEGS
GRELREPTVYNTGDYEQWTRVTVVIPRNVAASKTRFRWFQESSVYREAPPFALDGVYISE
PCPNHCGGHGDCISGVCFCDMGYTVEQDSCVPSVASPTELTEGFEGKLSPLWQSLSGGQI
GGGCGIISEGKALYFSSPGRRELRTVPLDTSNTRLVQFYIRIGSKSLGPTCTRPRSRNEG
VIVQFSTNNGVQWQFLRELDFSSFLEPQVVTIELPSAAKTPYTVFRWWQPQQGKHSAQWA
LDDVLIGMNDSSRTGFQDKFDGTTPLRHNWYRVQGGEVTVDCLSLDTALTFNSVAIDKKP
RYAETWDFEVSGSSFLQFELSMGCSKSTSFSHGVRLEYSTDCGQHWSLITPECVPPAIGC
SGYTQSSIYTSTQYKHWRRITVYLPSAANSPRTRFRWIQTHFTPGAEGWALDNVLLAPGC
PWMCSGHGLCDNGRCVCDKGYGGQHCVPVTPLPSVLREDFNDNLQQETWPELYGAERGTL
SGEPLKSGTALIFKGDGMRMIVSRDLDCTNTLYIQFSFKFITKGVPERSHSILLQYSVNG
GISWLMLDEFYFPTSTDTLFLHLALPASAQTNATRFRLWQPYNSGKKEEVWVIDDLIIDG
STLHNPPVVIDSFDEGPNDSNWLFFPGGNTGLYCPYQKTGLEEDESAMVFLSSELGEHSI
TTRDIEVNENTIIQFEINVGCTVESSSNYPVRLEFSRDFGATWHLLVPLCAGAPQPSALC
STELHPASIYFPGTTQGWRREVIHFGKLRLCGSVRFRWYQGFFSSGSSPPTWALDNIYIG
PQCQDMCNGHGACVGGTHCACDPGYSGSDCSVPDTPNPDFLKEDFEGGAVDAEHFRLLSG
GKPSRKCGIMSSGNHLFFSEDGLRMLVTNDMDLSNARFVQFFLRLGCGKAAPDPRSQPVL
LQFSVDGGLSWGLLQEFLFSNSSNQARLVALEIPLRARTTSTRIRWWQPSESGHFYSPWV
IDQVVVGGSASGWGPLEDDFSSIDGRSWLLHPGGTRMPVCGSDGPAFAFIEKSNTRYAVT
TDISLGQDAFIQFDFSASCSVTNSCYSVELEYSLDLGLSWQPLVRDCLPTSPDCSSYTLQ
RLLVSDTYNKWGRITLPIPSYARSPATRFRWLQQAPFDKQQTWALDNLYIGDGCPDMCSG
HGHCKQSSCVCDSEWGGEYCDEPVVPLPSQLKDSFSRAPSLSHWHTLTGAKLSTVCGAVA
SGAALHFSGGCSRQLVTVDLNLTNAEFIQFYFMYGCMIPPSNRNQGVLLEYSLNGGINWH
LLTEIFYDLYTKPGFVNVLLPPAARQEGVRVRWWQPQHDGVDHSDWALDNVLIAGSDPRA
QISDTFGGVALPNHERSPADGASGRIDQPNEQEETPIVSDHWLFSEDCSVQRFCSSPDGV
MVCGNTDGREVYAVTHDIVPDKDWVMQFKIAVGCSVPERHADRQVHVQYSVDFGVTWKYL
VPQTLMIMFTLVVGITRGLFSSAVRFRFYQQHSDIQWGVENFYIGPACESHCGGHGDCLD
QRCLCDPGFTGPNCYASSTLKASLKERFDWEGTSSPQWQVLEGGRPCTDCGVLVEGTALY
FGGADARHAVTADLDLRGAKFVEYWARIGSEDNMTLCHRPTCRKEGVLLDYSTDGGVSWT
LLHEMDYLKYVSVRRDYIVLPEGALTNATRLRWWQPFTISSGLATPSLERAQWAIDNILV
GGSDINPSTLLDTFDDEGVSHEESWSFYPNAVRTGFCGNPSFHLYWPNKNQDRTHNILAT
RELIVQPGYILQFKIAVGCEADTCEDHHSVLLQYRKDARSDSWQVVQSECLPSSVNNVGC
SPFQFHESTIYSPVNSSTWTRVTVQLPDHVSSELLSSGGSRRRGVESVRAGLLIMFILVK
PARGSAADTATVPADRCASVMRDTMVGHRLCGDASAVLLRGKSLRLNFITSSSPGWGSGQ
RLWAAVTACPGDSLYFNGCKMRQAVTKPLDLTRASKIMFVLQIGSVAQTDSCNIALDQAD
TVDRAVLLQYSVNNGISWHVIAQHQPKDFIKAQRVSYNIPLEARVKGVMLRWWQPRHDGA
GHDQWALDHVEVVLLYTRKQNYMMNFARQSGARHYYSRKKRALLQRA
Download sequence
Identical sequences H3BY06
ENSTNIP00000000871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]