SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000930 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000930
Domain Number 1 Region: 173-406
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 7.2e-82
Family Fibrinogen C-terminal domain-like 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000930   Gene: ENSTNIG00000012120   Transcript: ENSTNIT00000000833
Sequence length 408
Comment pep:novel chromosome:TETRAODON8:13:4905026:4909947:1 gene:ENSTNIG00000012120 transcript:ENSTNIT00000000833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDVTVTPEEPCEREEDDIRCPYLFNVPPLTIHLPKQLRELERMVQELQVLKDNVDELRRM
CADCTEKTDDRTDPPVSPDRTKETKIKTQSKENRSGDPATEPRPESTEIPNITQNQNILH
GGTKKLKQSRDPNCNKPTQRKDQKQLSITRHPDGPQNLRPSQSQKQNLRPRSVTVVMRDC
SDYLLRGQTKSRVYLVTPDLRSKSFPVFCDMELSGGGWTLLQRRQDGSVSFNRSWDQYRS
GFGELDGGEFWLGNNRIHLLTRERDMTLRVELEDFDGGKGFAEYSQFRVASERLRYTLTV
GGYSGNAGNALRFSKSYDHHHRAFTTPDRDHDRYPSGNCGAYYSSGWWFDACMAANLNGR
YYTGRYKGVRDGIYWGTWHNISSEYYPTNDRQSFKSVRMMIRPKGFVS
Download sequence
Identical sequences H3BY65
ENSTNIP00000000930 ENSTNIP00000000930 99883.ENSTNIP00000000930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]