SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000941 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000941
Domain Number 1 Region: 95-346
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-45
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 16-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000524
Family EGF-type module 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000941
Domain Number - Region: 58-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0018
Family EGF-type module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000941   Gene: ENSTNIG00000001001   Transcript: ENSTNIT00000003842
Sequence length 348
Comment pep:known_by_projection chromosome:TETRAODON8:2:12018607:12020118:-1 gene:ENSTNIG00000001001 transcript:ENSTNIT00000003842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQDSYRADIFWAVYVDGDQCAEKPCKNGAMCSDSVGGYDCVCKSGFTGVHCEKDETLCVV
DSDKGCSQFCKPGYTSHECSCAQGWKINNSDTTKCVPTGRFPCGRVSSVRQWESRMATNK
ENNFQGISCTSGECPWQALLKTSASRGFCSGVILKANLVLTSAQCARKYSSFQVAVGKRS
TSYEAGERTLRVKRVHVHPRFRGRSPDNDLAVVELSSSITYNKDTIAACLPEKDFAENVL
MKLPTAVTGWGRRPRRGPLMLNHLTYVSLADCLEAHPNLLTNKMGCTLPLANANCTMGSG
SPLLTMYKEVLFLTGVVSQPAGADCSKGYIVQKVSRYQSWLQSLMNLR
Download sequence
Identical sequences H3BY76
99883.ENSTNIP00000000941 ENSTNIP00000000941 ENSTNIP00000000941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]