SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000986 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000986
Domain Number 1 Region: 221-342
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-16
Family Cadherin 0.012
Further Details:      
 
Domain Number 3 Region: 325-441
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000144
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 108-225
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000357
Family Cadherin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000986   Gene: ENSTNIG00000008646   Transcript: ENSTNIT00000001253
Sequence length 617
Comment pep:known_by_projection chromosome:TETRAODON8:17:5875541:5881310:-1 gene:ENSTNIG00000008646 transcript:ENSTNIT00000001253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDTPPVFIGTPYFGYVYEISVPGSEIFTVVAKDGDVGNPNPIRYSFDDGDDGVFHINRTS
GLITLQTLPMFLKREIFNIKVRASEVNPQGRLLDYSITAVVIRVVDLNNNPPTFYGENGP
QSMFELTMYEHPPEGEILRGLKITVNDSDQGANAKFNLRLIGPGRMLRVVPQTVLNEAQV
TILVEDSAAMDYEKHHFLTYKLLAVEIDTPERFSATADIVIHLLDTNDNAPKFSTDYYIA
RIPENSPGGSNVVSVTAVDPDSGSWGEVKFSIYGSGADLFLIQPTSGIIYTQPWASLDAE
VRSKYNFYVKAEDAEGKYSLAEVFVTVLDLNDHPPAFNDNFLETTMVIGAPVKIEAVDDD
AEVPNNVIEYAIMKAEPDNNIFDINADTGEIVLKSYIKSMAIIQNITKQTDCTWSLVVQA
RDRGQPSFSTTAVVKIDITEATQLSGGPLGTFLMQNRNKPSQILGMLAGVIVLMVIITVV
ISTATYIRNKKSNRILPNRRVRRRRPQKQQAWNIKNPFKFQVEENEEPQPENVNYNNNVS
KVVSHWPPPPLPCAPSAPPPPPAYIPEGRQWTVPTVSATVAIKPKKRPAMHTQDNVNKAM
VSELKMRLEQKNLLKHH
Download sequence
Identical sequences H3BYC0
ENSTNIP00000000986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]