SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000994 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000994
Domain Number 1 Region: 31-99
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000974
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000994   Gene: ENSTNIG00000001533   Transcript: ENSTNIT00000004115
Sequence length 117
Comment pep:novel chromosome:TETRAODON8:Un_random:68685421:68686237:-1 gene:ENSTNIG00000001533 transcript:ENSTNIT00000004115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCQRAPVTMRQYKRYVAIMALLSFVSRTSASVTHYSIPEEMKEGSVVANLATDLGLGVKT
LNQRKMRLDIIANKKYLDVNKETGELYIVEKIDRENICNTKSSASCYLKLEVILDSP
Download sequence
Identical sequences H3BYC8
ENSTNIP00000000994 99883.ENSTNIP00000000994 ENSTNIP00000000994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]